Spo09219 (gene) | SpinachBase

Overview


Name	Spo09219
Type	gene
Organism	Spinacia oleracea (Spinach)
Description	Unknown protein
Location	chr6 : 14663767 .. 14664172 (-)

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGGCAAATTCCAAGCGAAAATGTATTATAACCAGTAAGTTTTGCCTGACCAACGATAAAGCTAACAATATGAGTTCCAGTGGTTAAACGTTGGATGAAATAGATACTCTTGAATGTTCTTTTAGTATTGAGGGTCATTTGTGTACATGTTGTATTGCGTAAAAGTGCAAAGCATGAAGCTATAAGTTTTTCCGTTTTGCTTGCAGAATTTCTAATCAAGGGGATATTGTGTTTGGTTAGAGAGGACAAATTGGCCGGCCAAGTGTCAGATATGTTTCAATGGAATACGGAAAAAGAAGAAAATATTCTGCACGCCTGTCTAAAGGATTCACTTTCTCCTACTCCACTGTTTCATATAGACCTTACTTTGAAGGGTAAAGAAGTGGTTCTGGACTCTGGACCTTGA

mRNA sequence

ATGGCAAATTCCAAGCGAAAATGTATTATAACCAAATTTCTAATCAAGGGGATATTGTGTTTGGTTAGAGAGGACAAATTGGCCGGCCAAGTGTCAGATATGTTTCAATGGAATACGGAAAAAGAAGAAAATATTCTGCACGCCTGTCTAAAGGATTCACTTTCTCCTACTCCACTGTTTCATATAGACCTTACTTTGAAGGGTAAAGAAGTGGTTCTGGACTCTGGACCTTGA

Coding sequence (CDS)

ATGGCAAATTCCAAGCGAAAATGTATTATAACCAAATTTCTAATCAAGGGGATATTGTGTTTGGTTAGAGAGGACAAATTGGCCGGCCAAGTGTCAGATATGTTTCAATGGAATACGGAAAAAGAAGAAAATATTCTGCACGCCTGTCTAAAGGATTCACTTTCTCCTACTCCACTGTTTCATATAGACCTTACTTTGAAGGGTAAAGAAGTGGTTCTGGACTCTGGACCTTGA

Protein sequence

MANSKRKCIITKFLIKGILCLVREDKLAGQVSDMFQWNTEKEENILHACLKDSLSPTPLFHIDLTLKGKEVVLDSGP

Relationships

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Type
Spo09219.1	Spo09219.1	mRNA

Homology

The following BLAST results are available for this feature:

BLAST of Spo09219.1 vs. NCBI nr
BLAST of Spo09219.1 vs. UniProtKB/TrEMBL
BLAST of Spo09219.1 vs. ExPASy Swiss-Prot
BLAST of Spo09219.1 vs. TAIR (Arabidopsis)

BLAST of Spo09219.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo09219.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo09219.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo09219.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

GO Annotation

GO Assignments

This gene is annotated with the following GO terms.

Category	Term Accession	Term Name
biological_process	GO:0031048	chromatin silencing by small RNA
biological_process	GO:0009616	virus induced gene silencing
biological_process	GO:0009887	animal organ morphogenesis
biological_process	GO:0007267	cell-cell signaling
biological_process	GO:0006306	DNA methylation
biological_process	GO:0006260	DNA replication
biological_process	GO:0010073	meristem maintenance
biological_process	GO:0006346	methylation-dependent chromatin silencing
biological_process	GO:0035196	production of miRNAs involved in gene silencing by miRNA
biological_process	GO:0010267	production of ta-siRNAs involved in RNA interference
biological_process	GO:0006355	regulation of transcription, DNA-templated
biological_process	GO:0000394	RNA splicing, via endonucleolytic cleavage and ligation
biological_process	GO:0006366	transcription by RNA polymerase II
biological_process	GO:0010050	vegetative phase change
biological_process	GO:0010228	vegetative to reproductive phase transition of meristem
biological_process	GO:0015940	pantothenate biosynthetic process
biological_process	GO:0031124	mRNA 3'-end processing
biological_process	GO:0000956	nuclear-transcribed mRNA catabolic process
biological_process	GO:0009791	post-embryonic development
biological_process	GO:0032527	protein exit from endoplasmic reticulum
biological_process	GO:0009639	response to red or far red light
biological_process	GO:0007033	vacuole organization
biological_process	GO:0048280	vesicle fusion with Golgi apparatus
biological_process	GO:0016567	protein ubiquitination
biological_process	GO:0006354	DNA-templated transcription, elongation
biological_process	GO:0009220	pyrimidine ribonucleotide biosynthetic process
biological_process	GO:0042254	ribosome biogenesis
biological_process	GO:0006412	translation
biological_process	GO:0016070	RNA metabolic process
biological_process	GO:0048440	carpel development
biological_process	GO:0006281	DNA repair
biological_process	GO:0009058	biosynthetic process
biological_process	GO:0010338	leaf formation
biological_process	GO:0030433	ubiquitin-dependent ERAD pathway
biological_process	GO:0042023	DNA endoreduplication
biological_process	GO:2000123	positive regulation of stomatal complex development
biological_process	GO:0043248	proteasome assembly
biological_process	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
biological_process	GO:0051726	regulation of cell cycle
biological_process	GO:0051302	regulation of cell division
biological_process	GO:0010389	regulation of G2/M transition of mitotic cell cycle
biological_process	GO:0045859	regulation of protein kinase activity
biological_process	GO:0051510	regulation of unidimensional cell growth
biological_process	GO:0051788	response to misfolded protein
biological_process	GO:0097502	mannosylation
biological_process	GO:0006490	oligosaccharide-lipid intermediate biosynthetic process
biological_process	GO:0016310	phosphorylation
biological_process	GO:0009069	serine family amino acid metabolic process
biological_process	GO:0048731	system development
biological_process	GO:0007165	signal transduction
biological_process	GO:0009793	embryo development ending in seed dormancy
biological_process	GO:0016579	protein deubiquitination
biological_process	GO:0048767	root hair elongation
biological_process	GO:0006979	response to oxidative stress
biological_process	GO:0044237	cellular metabolic process
biological_process	GO:0010467	gene expression
biological_process	GO:0033036	macromolecule localization
biological_process	GO:0009560	embryo sac egg cell differentiation
biological_process	GO:0071702	organic substance transport
biological_process	GO:0044238	primary metabolic process
biological_process	GO:0050794	regulation of cellular process
biological_process	GO:0050793	regulation of developmental process
biological_process	GO:0050896	response to stimulus
biological_process	GO:0051567	histone H3-K9 methylation
biological_process	GO:0010358	leaf shaping
biological_process	GO:0051301	cell division
biological_process	GO:0052542	defense response by callose deposition
biological_process	GO:0032508	DNA duplex unwinding
biological_process	GO:0006289	nucleotide-excision repair
biological_process	GO:0051252	regulation of RNA metabolic process
biological_process	GO:0010020	chloroplast fission
biological_process	GO:0016559	peroxisome fission
biological_process	GO:0007276	gamete generation
biological_process	GO:0009561	megagametogenesis
biological_process	GO:0032875	regulation of DNA endoreduplication
biological_process	GO:0000398	mRNA splicing, via spliceosome
biological_process	GO:0006629	lipid metabolic process
biological_process	GO:0000910	cytokinesis
biological_process	GO:0000226	microtubule cytoskeleton organization
biological_process	GO:0006623	protein targeting to vacuole
biological_process	GO:0030968	endoplasmic reticulum unfolded protein response
biological_process	GO:0015031	protein transport
biological_process	GO:0043069	negative regulation of programmed cell death
biological_process	GO:0006612	protein targeting to membrane
biological_process	GO:0010363	regulation of plant-type hypersensitive response
biological_process	GO:0010200	response to chitin
biological_process	GO:0006397	mRNA processing
biological_process	GO:0042147	retrograde transport, endosome to Golgi
biological_process	GO:0048193	Golgi vesicle transport
biological_process	GO:0009395	phospholipid catabolic process
biological_process	GO:0009073	aromatic amino acid family biosynthetic process
biological_process	GO:0016226	iron-sulfur cluster assembly
biological_process	GO:0000902	cell morphogenesis
biological_process	GO:0006888	ER to Golgi vesicle-mediated transport
biological_process	GO:0061025	membrane fusion
biological_process	GO:0032482	Rab protein signal transduction
biological_process	GO:0007034	vacuolar transport
biological_process	GO:0070676	intralumenal vesicle formation
biological_process	GO:0010305	leaf vascular tissue pattern formation
biological_process	GO:0010082	regulation of root meristem growth
biological_process	GO:0019915	lipid storage
biological_process	GO:0010074	maintenance of meristem identity
biological_process	GO:0006406	mRNA export from nucleus
biological_process	GO:0048451	petal formation
biological_process	GO:0009640	photomorphogenesis
biological_process	GO:0045893	positive regulation of transcription, DNA-templated
biological_process	GO:0043687	post-translational protein modification
biological_process	GO:0000338	protein deneddylation
biological_process	GO:0006606	protein import into nucleus
biological_process	GO:0000413	protein peptidyl-prolyl isomerization
biological_process	GO:0007131	reciprocal meiotic recombination
biological_process	GO:0009909	regulation of flower development
biological_process	GO:0031060	regulation of histone methylation
biological_process	GO:0032204	regulation of telomere maintenance
biological_process	GO:0001510	RNA methylation
biological_process	GO:0050826	response to freezing
biological_process	GO:0010332	response to gamma radiation
biological_process	GO:0006396	RNA processing
biological_process	GO:0010162	seed dormancy process
biological_process	GO:0009845	seed germination
biological_process	GO:0048453	sepal formation
biological_process	GO:0048443	stamen development
biological_process	GO:0010182	sugar mediated signaling pathway
biological_process	GO:0043247	telomere maintenance in response to DNA damage
biological_process	GO:0015991	ATP hydrolysis coupled proton transport
biological_process	GO:0046835	carbohydrate phosphorylation
biological_process	GO:0046396	D-galacturonate metabolic process
biological_process	GO:0006012	galactose metabolic process
biological_process	GO:0009117	nucleotide metabolic process
biological_process	GO:0008283	cell proliferation
biological_process	GO:0006807	nitrogen compound metabolic process
biological_process	GO:0050999	regulation of nitric-oxide synthase activity
biological_process	GO:0045595	regulation of cell differentiation
biological_process	GO:0007155	cell adhesion
biological_process	GO:0016049	cell growth
biological_process	GO:0071555	cell wall organization
biological_process	GO:0048589	developmental growth
biological_process	GO:0006897	endocytosis
biological_process	GO:0048449	floral organ formation
biological_process	GO:0048439	flower morphogenesis
biological_process	GO:0009965	leaf morphogenesis
biological_process	GO:0000278	mitotic cell cycle
biological_process	GO:0048519	negative regulation of biological process
biological_process	GO:0043547	positive regulation of GTPase activity
biological_process	GO:0033044	regulation of chromosome organization
biological_process	GO:0033587	shikimate biosynthetic process
biological_process	GO:0043087	regulation of GTPase activity
biological_process	GO:0009733	response to auxin
biological_process	GO:0048765	root hair cell differentiation
biological_process	GO:0010090	trichome morphogenesis
biological_process	GO:0010051	xylem and phloem pattern formation
biological_process	GO:0010089	xylem development
biological_process	GO:0006633	fatty acid biosynthetic process
biological_process	GO:0042967	obsolete acyl-carrier-protein biosynthetic process
biological_process	GO:0055114	oxidation-reduction process
biological_process	GO:0006816	calcium ion transport
biological_process	GO:0006486	protein glycosylation
biological_process	GO:0045010	actin nucleation
biological_process	GO:0006098	pentose-phosphate shunt
biological_process	GO:0006885	regulation of pH
biological_process	GO:0072593	reactive oxygen species metabolic process
biological_process	GO:0009630	gravitropism
biological_process	GO:0045132	meiotic chromosome segregation
biological_process	GO:0006312	mitotic recombination
biological_process	GO:0007062	sister chromatid cohesion
biological_process	GO:0000023	maltose metabolic process
biological_process	GO:0046838	phosphorylated carbohydrate dephosphorylation
biological_process	GO:0043085	positive regulation of catalytic activity
biological_process	GO:0006470	protein dephosphorylation
biological_process	GO:0019252	starch biosynthetic process
biological_process	GO:0005983	starch catabolic process
biological_process	GO:0031047	gene silencing by RNA
biological_process	GO:0006721	terpenoid metabolic process
biological_process	GO:0009809	lignin biosynthetic process
biological_process	GO:0016043	cellular component organization
biological_process	GO:0009987	cellular process
biological_process	GO:0009855	determination of bilateral symmetry
biological_process	GO:0006886	intracellular protein transport
biological_process	GO:0010014	meristem initiation
biological_process	GO:0006913	nucleocytoplasmic transport
biological_process	GO:0009944	polarity specification of adaxial/abaxial axis
biological_process	GO:0010075	regulation of meristem growth
biological_process	GO:0007264	small GTPase mediated signal transduction
biological_process	GO:0009060	aerobic respiration
biological_process	GO:0006096	glycolytic process
biological_process	GO:0070588	calcium ion transmembrane transport
biological_process	GO:0006468	protein phosphorylation
biological_process	GO:0006144	purine nucleobase metabolic process
biological_process	GO:0015996	chlorophyll catabolic process
biological_process	GO:0006810	transport
biological_process	GO:0006508	proteolysis
biological_process	GO:0032502	developmental process
biological_process	GO:0006857	oligopeptide transport
biological_process	GO:0071816	tail-anchored membrane protein insertion into ER membrane
biological_process	GO:0006206	pyrimidine nucleobase metabolic process
biological_process	GO:0055085	transmembrane transport
biological_process	GO:0006511	ubiquitin-dependent protein catabolic process
biological_process	GO:0006457	protein folding
biological_process	GO:0052546	cell wall pectin metabolic process
biological_process	GO:0006075	(1->3)-beta-D-glucan biosynthetic process
biological_process	GO:0005982	starch metabolic process
biological_process	GO:0005985	sucrose metabolic process
biological_process	GO:0032259	methylation
biological_process	GO:0008152	metabolic process
biological_process	GO:0006351	transcription, DNA-templated
cellular_component	GO:0005634	nucleus
cellular_component	GO:0005770	late endosome
cellular_component	GO:0005657	replication fork
cellular_component	GO:0000136	alpha-1,6-mannosyltransferase complex
cellular_component	GO:0033179	proton-transporting V-type ATPase, V0 domain
cellular_component	GO:0000815	ESCRT III complex
cellular_component	GO:0005789	endoplasmic reticulum membrane
cellular_component	GO:0005886	plasma membrane
cellular_component	GO:0055029	nuclear DNA-directed RNA polymerase complex
cellular_component	GO:0009570	chloroplast stroma
cellular_component	GO:0005739	mitochondrion
cellular_component	GO:0009506	plasmodesma
cellular_component	GO:0005681	spliceosomal complex
cellular_component	GO:0044434	chloroplast part
cellular_component	GO:0005783	endoplasmic reticulum
cellular_component	GO:0005773	vacuole
cellular_component	GO:0009507	chloroplast
cellular_component	GO:0005829	cytosol
cellular_component	GO:0030904	retromer complex
cellular_component	GO:0031902	late endosome membrane
cellular_component	GO:0005794	Golgi apparatus
cellular_component	GO:0008287	protein serine/threonine phosphatase complex
cellular_component	GO:0016021	integral component of membrane
cellular_component	GO:0009707	chloroplast outer membrane
cellular_component	GO:0032040	small-subunit processome
cellular_component	GO:0045298	tubulin complex
cellular_component	GO:0043231	intracellular membrane-bounded organelle
cellular_component	GO:0044444	cytoplasmic part
cellular_component	GO:0000785	chromatin
cellular_component	GO:0019013	viral nucleocapsid
cellular_component	GO:0005819	spindle
cellular_component	GO:0005777	peroxisome
cellular_component	GO:0031461	cullin-RING ubiquitin ligase complex
cellular_component	GO:0005622	intracellular
cellular_component	GO:0005795	Golgi stack
cellular_component	GO:0035101	FACT complex
cellular_component	GO:0005840	ribosome
cellular_component	GO:0030140	trans-Golgi network transport vesicle
cellular_component	GO:0005849	mRNA cleavage factor complex
cellular_component	GO:0005667	transcription factor complex
cellular_component	GO:0005643	nuclear pore
cellular_component	GO:0005835	fatty acid synthase complex
cellular_component	GO:0005665	DNA-directed RNA polymerase II, core complex
cellular_component	GO:0005719	nuclear euchromatin
cellular_component	GO:0005768	endosome
cellular_component	GO:0005730	nucleolus
cellular_component	GO:0005774	vacuolar membrane
cellular_component	GO:0000139	Golgi membrane
cellular_component	GO:0005802	trans-Golgi network
cellular_component	GO:0009536	plastid
cellular_component	GO:0016020	membrane
cellular_component	GO:0000148	1,3-beta-D-glucan synthase complex
molecular_function	GO:0019905	syntaxin binding
molecular_function	GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity
molecular_function	GO:0008270	zinc ion binding
molecular_function	GO:0008138	protein tyrosine/serine/threonine phosphatase activity
molecular_function	GO:0016757	transferase activity, transferring glycosyl groups
molecular_function	GO:0008017	microtubule binding
molecular_function	GO:0016787	hydrolase activity
molecular_function	GO:0005516	calmodulin binding
molecular_function	GO:0003682	chromatin binding
molecular_function	GO:0016874	ligase activity
molecular_function	GO:0050308	sugar-phosphatase activity
molecular_function	GO:2001070	starch binding
molecular_function	GO:0004316	3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
molecular_function	GO:0008757	S-adenosylmethionine-dependent methyltransferase activity
molecular_function	GO:0051082	unfolded protein binding
molecular_function	GO:0004620	phospholipase activity
molecular_function	GO:0019003	GDP binding
molecular_function	GO:0046983	protein dimerization activity
molecular_function	GO:0008168	methyltransferase activity
molecular_function	GO:0003676	nucleic acid binding
molecular_function	GO:0035673	oligopeptide transmembrane transporter activity
molecular_function	GO:0004842	ubiquitin-protein transferase activity
molecular_function	GO:0016491	oxidoreductase activity
molecular_function	GO:0008374	O-acyltransferase activity
molecular_function	GO:0000287	magnesium ion binding
molecular_function	GO:0005488	binding
molecular_function	GO:0032440	2-alkenal reductase [NAD(P)] activity
molecular_function	GO:0003700	DNA-binding transcription factor activity
molecular_function	GO:0051213	dioxygenase activity
molecular_function	GO:0004674	protein serine/threonine kinase activity
molecular_function	GO:0003677	DNA binding
molecular_function	GO:0004722	protein serine/threonine phosphatase activity
molecular_function	GO:0008897	holo-[acyl-carrier-protein] synthase activity
molecular_function	GO:0051287	NAD binding
molecular_function	GO:0008234	cysteine-type peptidase activity
molecular_function	GO:0008233	peptidase activity
molecular_function	GO:0005525	GTP binding
molecular_function	GO:0004335	galactokinase activity
molecular_function	GO:0016301	kinase activity
molecular_function	GO:0015369	calcium:proton antiporter activity
molecular_function	GO:0003824	catalytic activity
molecular_function	GO:0015078	proton transmembrane transporter activity
molecular_function	GO:0003924	GTPase activity
molecular_function	GO:0003755	peptidyl-prolyl cis-trans isomerase activity
molecular_function	GO:0042393	histone binding
molecular_function	GO:0004697	protein kinase C activity
molecular_function	GO:0046872	metal ion binding
molecular_function	GO:0000166	nucleotide binding
molecular_function	GO:0004386	helicase activity
molecular_function	GO:0003899	DNA-directed 5'-3' RNA polymerase activity
molecular_function	GO:0004801	sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity
molecular_function	GO:0008242	omega peptidase activity
molecular_function	GO:0004843	thiol-dependent ubiquitin-specific protease activity
molecular_function	GO:0004601	peroxidase activity
molecular_function	GO:0031625	ubiquitin protein ligase binding
molecular_function	GO:0047912	galacturonokinase activity
molecular_function	GO:0004377	GDP-Man:Man3GlcNAc2-PP-Dol alpha-1,2-mannosyltransferase activity
molecular_function	GO:0017111	nucleoside-triphosphatase activity
molecular_function	GO:0005096	GTPase activator activity
molecular_function	GO:0042802	identical protein binding
molecular_function	GO:0008565	protein transporter activity
molecular_function	GO:0036459	thiol-dependent ubiquitinyl hydrolase activity
molecular_function	GO:0004672	protein kinase activity
molecular_function	GO:0005509	calcium ion binding
molecular_function	GO:0035091	phosphatidylinositol binding
molecular_function	GO:0004525	ribonuclease III activity
molecular_function	GO:0097159	organic cyclic compound binding
molecular_function	GO:0019843	rRNA binding
molecular_function	GO:0008171	O-methyltransferase activity
molecular_function	GO:0004003	ATP-dependent DNA helicase activity
molecular_function	GO:0005524	ATP binding
molecular_function	GO:0005515	protein binding
molecular_function	GO:0003735	structural constituent of ribosome
molecular_function	GO:0003723	RNA binding
molecular_function	GO:0052926	dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase activity
molecular_function	GO:0052918	dol-P-Man:Man(8)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase activity
molecular_function	GO:0008173	RNA methyltransferase activity
molecular_function	GO:0003843	1,3-beta-D-glucan synthase activity

RNA-Seq Expression

Co-expression


Gene	r value	Expression
Spo20826	0.79	Barchart \| Table
Spo01801	0.78	Barchart \| Table
Spo26833	0.77	Barchart \| Table
Spo22970	0.76	Barchart \| Table
Spo02254	0.76	Barchart \| Table
Spo03197	0.76	Barchart \| Table
Spo17386	0.76	Barchart \| Table
Spo23507	0.76	Barchart \| Table
Spo23355	0.76	Barchart \| Table
Spo20242	0.76	Barchart \| Table
Spo22747	0.76	Barchart \| Table
Spo17755	0.75	Barchart \| Table
Spo07415	0.75	Barchart \| Table
Spo22894	0.75	Barchart \| Table
Spo09062	0.75	Barchart \| Table
Spo01397	0.75	Barchart \| Table
Spo06465	0.75	Barchart \| Table
Spo11384	0.75	Barchart \| Table
Spo12155	0.75	Barchart \| Table
Spo05127	0.75	Barchart \| Table
Spo01885	0.75	Barchart \| Table
Spo03002	0.74	Barchart \| Table
Spo17123	0.74	Barchart \| Table
Spo11680	0.74	Barchart \| Table
Spo02115	0.74	Barchart \| Table
Spo14084	0.74	Barchart \| Table
Spo16759	0.74	Barchart \| Table
Spo06464	0.74	Barchart \| Table
Spo26560	0.74	Barchart \| Table
Spo02818	0.73	Barchart \| Table
Spo00694	0.73	Barchart \| Table
Spo25851	0.73	Barchart \| Table
Spo06962	0.73	Barchart \| Table
Spo01181	0.73	Barchart \| Table
Spo12400	0.73	Barchart \| Table
Spo21465	0.73	Barchart \| Table
Spo20118	0.73	Barchart \| Table
Spo02065	0.73	Barchart \| Table
Spo02731	0.73	Barchart \| Table
Spo04985	0.73	Barchart \| Table
Spo25879	0.73	Barchart \| Table
Spo14826	0.72	Barchart \| Table
Spo05124	0.72	Barchart \| Table
Spo05928	0.72	Barchart \| Table
Spo07694	0.72	Barchart \| Table
Spo01313	0.72	Barchart \| Table
Spo07079	0.72	Barchart \| Table
Spo01216	0.72	Barchart \| Table
Spo24890	0.72	Barchart \| Table
Spo01841	0.72	Barchart \| Table
Spo02013	0.72	Barchart \| Table
Spo05640	0.72	Barchart \| Table
Spo24468	0.72	Barchart \| Table
Spo16161	0.72	Barchart \| Table
Spo00751	0.72	Barchart \| Table
Spo16881	0.72	Barchart \| Table
Spo02499	0.72	Barchart \| Table
Spo05603	0.72	Barchart \| Table
Spo02672	0.72	Barchart \| Table
Spo23346	0.72	Barchart \| Table
Spo06291	0.72	Barchart \| Table
Spo16421	0.71	Barchart \| Table
Spo13527	0.71	Barchart \| Table
Spo11069	0.71	Barchart \| Table
Spo12749	0.71	Barchart \| Table
Spo24294	0.71	Barchart \| Table
Spo24241	0.71	Barchart \| Table
Spo24092	0.71	Barchart \| Table
Spo24066	0.71	Barchart \| Table
Spo03865	0.71	Barchart \| Table
Spo23071	0.71	Barchart \| Table
Spo04885	0.71	Barchart \| Table
Spo04933	0.71	Barchart \| Table
Spo00397	0.71	Barchart \| Table
Spo20696	0.71	Barchart \| Table
Spo20303	0.71	Barchart \| Table
Spo19558	0.71	Barchart \| Table
Spo26482	0.71	Barchart \| Table
Spo19287	0.71	Barchart \| Table
Spo07199	0.71	Barchart \| Table
Spo07724	0.71	Barchart \| Table
Spo17340	0.71	Barchart \| Table
Spo00783	0.71	Barchart \| Table
Spo16732	0.71	Barchart \| Table
Spo16529	0.71	Barchart \| Table
Spo15424	0.71	Barchart \| Table
Spo15420	0.71	Barchart \| Table
Spo14942	0.71	Barchart \| Table
Spo10673	0.71	Barchart \| Table
Spo23668	0.70	Barchart \| Table
Spo00536	0.70	Barchart \| Table
Spo28135	0.70	Barchart \| Table
Spo01048	0.70	Barchart \| Table
Spo02407	0.70	Barchart \| Table
Spo00299	0.70	Barchart \| Table
Spo19486	0.70	Barchart \| Table
Spo00161	0.70	Barchart \| Table
Spo24598	0.70	Barchart \| Table
Spo01706	0.70	Barchart \| Table
Spo18269	0.70	Barchart \| Table
Spo17887	0.70	Barchart \| Table
Spo25013	0.70	Barchart \| Table
Spo25230	0.70	Barchart \| Table
Spo11641	0.70	Barchart \| Table
Spo14172	0.70	Barchart \| Table
Spo17329	0.70	Barchart \| Table
Spo08504	0.70	Barchart \| Table
Spo11993	0.70	Barchart \| Table
Spo08613	0.70	Barchart \| Table
Spo17098	0.70	Barchart \| Table
Spo13031	0.70	Barchart \| Table
Spo16297	0.70	Barchart \| Table
Spo04815	0.70	Barchart \| Table
Spo04542	0.70	Barchart \| Table
Spo23589	0.70	Barchart \| Table
Spo22750	0.70	Barchart \| Table
Spo22458	0.70	Barchart \| Table
Spo10650	0.70	Barchart \| Table
Spo23611	0.70	Barchart \| Table
Spo17547	0.69	Barchart \| Table
Spo17475	0.69	Barchart \| Table
Spo09842	0.69	Barchart \| Table
Spo15865	0.69	Barchart \| Table
Spo04448	0.69	Barchart \| Table
Spo17235	0.69	Barchart \| Table
Spo23556	0.69	Barchart \| Table
Spo23771	0.69	Barchart \| Table
Spo03525	0.69	Barchart \| Table
Spo23664	0.69	Barchart \| Table
Spo17021	0.69	Barchart \| Table
Spo16882	0.69	Barchart \| Table
Spo12511	0.69	Barchart \| Table
Spo08963	0.69	Barchart \| Table
Spo12719	0.69	Barchart \| Table
Spo11190	0.69	Barchart \| Table
Spo23908	0.69	Barchart \| Table
Spo09993	0.69	Barchart \| Table
Spo23957	0.69	Barchart \| Table
Spo10500	0.69	Barchart \| Table
Spo02747	0.69	Barchart \| Table
Spo16804	0.69	Barchart \| Table
Spo20244	0.69	Barchart \| Table
Spo12940	0.69	Barchart \| Table
Spo27365	0.69	Barchart \| Table
Spo15391	0.69	Barchart \| Table
Spo15270	0.69	Barchart \| Table
Spo10595	0.69	Barchart \| Table
Spo24549	0.69	Barchart \| Table
Spo16687	0.69	Barchart \| Table
Spo14008	0.69	Barchart \| Table
Spo07015	0.69	Barchart \| Table
Spo27004	0.69	Barchart \| Table
Spo19172	0.69	Barchart \| Table
Spo10394	0.69	Barchart \| Table
Spo01663	0.69	Barchart \| Table
Spo03073	0.69	Barchart \| Table
Spo07441	0.69	Barchart \| Table
Spo13492	0.69	Barchart \| Table
Spo05444	0.69	Barchart \| Table
Spo21132	0.69	Barchart \| Table
Spo17589	0.69	Barchart \| Table
Spo14995	0.69	Barchart \| Table
Spo20912	0.68	Barchart \| Table
Spo00579	0.68	Barchart \| Table
Spo00812	0.68	Barchart \| Table
Spo02280	0.68	Barchart \| Table
Spo02347	0.68	Barchart \| Table
Spo03344	0.68	Barchart \| Table
Spo03851	0.68	Barchart \| Table
Spo05487	0.68	Barchart \| Table
Spo05955	0.68	Barchart \| Table
Spo05968	0.68	Barchart \| Table
Spo06041	0.68	Barchart \| Table
Spo06748	0.68	Barchart \| Table
Spo06905	0.68	Barchart \| Table
Spo08884	0.68	Barchart \| Table
Spo09120	0.68	Barchart \| Table
Spo10251	0.68	Barchart \| Table
Spo10661	0.68	Barchart \| Table
Spo10850	0.68	Barchart \| Table
Spo11095	0.68	Barchart \| Table
Spo11741	0.68	Barchart \| Table
Spo11919	0.68	Barchart \| Table
Spo12201	0.68	Barchart \| Table
Spo13318	0.68	Barchart \| Table
Spo14827	0.68	Barchart \| Table
Spo14980	0.68	Barchart \| Table
Spo17391	0.68	Barchart \| Table
Spo18451	0.68	Barchart \| Table
Spo18961	0.68	Barchart \| Table
Spo19131	0.68	Barchart \| Table
Spo20045	0.68	Barchart \| Table
Spo20083	0.68	Barchart \| Table
Spo20187	0.68	Barchart \| Table
Spo20704	0.68	Barchart \| Table
Spo20900	0.68	Barchart \| Table
Spo20957	0.68	Barchart \| Table
Spo21431	0.68	Barchart \| Table
Spo21493	0.68	Barchart \| Table
Spo21729	0.68	Barchart \| Table
Spo22053	0.68	Barchart \| Table
Spo22256	0.68	Barchart \| Table
Spo22955	0.68	Barchart \| Table
Spo23527	0.68	Barchart \| Table
Spo23710	0.68	Barchart \| Table
Spo23889	0.68	Barchart \| Table
Spo24232	0.68	Barchart \| Table
Spo25330	0.68	Barchart \| Table
Spo25417	0.68	Barchart \| Table
Spo25497	0.68	Barchart \| Table
Spo26100	0.68	Barchart \| Table
Spo30027	0.68	Barchart \| Table
Spo06344	0.67	Barchart \| Table
Spo08408	0.67	Barchart \| Table
Spo20566	0.67	Barchart \| Table
Spo17291	0.67	Barchart \| Table
Spo20693	0.67	Barchart \| Table
Spo13516	0.67	Barchart \| Table
Spo13138	0.67	Barchart \| Table
Spo08094	0.67	Barchart \| Table
Spo11554	0.67	Barchart \| Table
Spo09764	0.67	Barchart \| Table
Spo11768	0.67	Barchart \| Table
Spo10966	0.67	Barchart \| Table
Spo11021	0.67	Barchart \| Table
Spo26148	0.67	Barchart \| Table
Spo10421	0.67	Barchart \| Table
Spo05781	0.67	Barchart \| Table
Spo11745	0.67	Barchart \| Table
Spo21179	0.67	Barchart \| Table
Spo14589	0.67	Barchart \| Table
Spo24667	0.67	Barchart \| Table
Spo00581	0.67	Barchart \| Table
Spo21558	0.67	Barchart \| Table
Spo24600	0.67	Barchart \| Table
Spo10222	0.67	Barchart \| Table
Spo24544	0.67	Barchart \| Table
Spo13953	0.67	Barchart \| Table
Spo02175	0.67	Barchart \| Table
Spo07609	0.67	Barchart \| Table
Spo26690	0.67	Barchart \| Table
Spo15362	0.67	Barchart \| Table
Spo05405	0.67	Barchart \| Table
Spo07586	0.67	Barchart \| Table
Spo22748	0.67	Barchart \| Table
Spo17889	0.67	Barchart \| Table
Spo10164	0.67	Barchart \| Table
Spo00362	0.67	Barchart \| Table
Spo11202	0.67	Barchart \| Table
Spo22940	0.67	Barchart \| Table
Spo26738	0.67	Barchart \| Table
Spo22956	0.67	Barchart \| Table
Spo23930	0.67	Barchart \| Table
Spo07426	0.67	Barchart \| Table
Spo04703	0.67	Barchart \| Table
Spo23263	0.67	Barchart \| Table
Spo09266	0.67	Barchart \| Table
Spo14919	0.67	Barchart \| Table
Spo26814	0.67	Barchart \| Table
Spo02984	0.67	Barchart \| Table
Spo04104	0.67	Barchart \| Table
Spo23580	0.67	Barchart \| Table
Spo18453	0.67	Barchart \| Table
Spo10793	0.67	Barchart \| Table
Spo03196	0.67	Barchart \| Table
Spo23617	0.67	Barchart \| Table
Spo03185	0.67	Barchart \| Table
Spo26805	0.67	Barchart \| Table
Spo00308	0.67	Barchart \| Table
Spo09162	0.67	Barchart \| Table
Spo08969	0.67	Barchart \| Table
Spo07178	0.67	Barchart \| Table
Spo06941	0.67	Barchart \| Table
Spo06752	0.67	Barchart \| Table
Spo19518	0.67	Barchart \| Table
Spo15426	0.67	Barchart \| Table
Spo08813	0.67	Barchart \| Table
Spo11243	0.67	Barchart \| Table
Spo01516	0.67	Barchart \| Table
Spo11349	0.67	Barchart \| Table
Spo09940	0.67	Barchart \| Table
Spo11482	0.67	Barchart \| Table
Spo10931	0.67	Barchart \| Table
Spo12364	0.67	Barchart \| Table
Spo06681	0.67	Barchart \| Table
Spo16088	0.67	Barchart \| Table
Spo17778	0.66	Barchart \| Table
Spo10443	0.66	Barchart \| Table
Spo10097	0.66	Barchart \| Table
Spo15723	0.66	Barchart \| Table
Spo09754	0.66	Barchart \| Table
Spo09752	0.66	Barchart \| Table
Spo16431	0.66	Barchart \| Table
Spo16584	0.66	Barchart \| Table
Spo09622	0.66	Barchart \| Table
Spo16733	0.66	Barchart \| Table
Spo09260	0.66	Barchart \| Table
Spo08850	0.66	Barchart \| Table
Spo08772	0.66	Barchart \| Table
Spo08541	0.66	Barchart \| Table
Spo17225	0.66	Barchart \| Table
Spo17388	0.66	Barchart \| Table
Spo17490	0.66	Barchart \| Table
Spo07882	0.66	Barchart \| Table
Spo07700	0.66	Barchart \| Table
Spo17677	0.66	Barchart \| Table
Spo25104	0.66	Barchart \| Table
Spo17959	0.66	Barchart \| Table
Spo18300	0.66	Barchart \| Table
Spo25244	0.66	Barchart \| Table
Spo18694	0.66	Barchart \| Table
Spo18977	0.66	Barchart \| Table
Spo00169	0.66	Barchart \| Table
Spo06729	0.66	Barchart \| Table
Spo19703	0.66	Barchart \| Table
Spo19874	0.66	Barchart \| Table
Spo01146	0.66	Barchart \| Table
Spo01097	0.66	Barchart \| Table
Spo06673	0.66	Barchart \| Table
Spo20497	0.66	Barchart \| Table
Spo20579	0.66	Barchart \| Table
Spo06249	0.66	Barchart \| Table
Spo25936	0.66	Barchart \| Table
Spo05948	0.66	Barchart \| Table
Spo20858	0.66	Barchart \| Table
Spo20909	0.66	Barchart \| Table
Spo00099	0.66	Barchart \| Table
Spo21005	0.66	Barchart \| Table
Spo00615	0.66	Barchart \| Table
Spo21650	0.66	Barchart \| Table
Spo26646	0.66	Barchart \| Table
Spo22047	0.66	Barchart \| Table
Spo26706	0.66	Barchart \| Table
Spo05306	0.66	Barchart \| Table
Spo05192	0.66	Barchart \| Table
Spo22859	0.66	Barchart \| Table
Spo22906	0.66	Barchart \| Table
Spo22972	0.66	Barchart \| Table
Spo04657	0.66	Barchart \| Table
Spo04384	0.66	Barchart \| Table
Spo23588	0.66	Barchart \| Table
Spo03662	0.66	Barchart \| Table
Spo23801	0.66	Barchart \| Table
Spo02871	0.66	Barchart \| Table
Spo02848	0.66	Barchart \| Table
Spo02749	0.66	Barchart \| Table
Spo24287	0.66	Barchart \| Table
Spo02345	0.66	Barchart \| Table
Spo02107	0.66	Barchart \| Table
Spo24566	0.66	Barchart \| Table
Spo24590	0.66	Barchart \| Table
Spo01913	0.66	Barchart \| Table
Spo24654	0.66	Barchart \| Table
Spo24706	0.66	Barchart \| Table
Spo11911	0.66	Barchart \| Table
Spo01873	0.66	Barchart \| Table
Spo12221	0.66	Barchart \| Table
Spo12852	0.66	Barchart \| Table
Spo25103	0.66	Barchart \| Table
Spo10940	0.66	Barchart \| Table
Spo13912	0.66	Barchart \| Table
Spo10736	0.66	Barchart \| Table
Spo10618	0.66	Barchart \| Table
Spo21599	0.65	Barchart \| Table
Spo14639	0.65	Barchart \| Table
Spo05670	0.65	Barchart \| Table
Spo08327	0.65	Barchart \| Table
Spo21175	0.65	Barchart \| Table
Spo30013	0.65	Barchart \| Table
Spo17220	0.65	Barchart \| Table
Spo15087	0.65	Barchart \| Table
Spo11623	0.65	Barchart \| Table
Spo20852	0.65	Barchart \| Table
Spo01590	0.65	Barchart \| Table
Spo09671	0.65	Barchart \| Table
Spo20197	0.65	Barchart \| Table
Spo03063	0.65	Barchart \| Table
Spo26800	0.65	Barchart \| Table
Spo06726	0.65	Barchart \| Table
Spo04160	0.65	Barchart \| Table
Spo00137	0.65	Barchart \| Table
Spo04865	0.65	Barchart \| Table
Spo12710	0.65	Barchart \| Table
Spo19840	0.65	Barchart \| Table
Spo02693	0.65	Barchart \| Table
Spo04973	0.65	Barchart \| Table
Spo02647	0.65	Barchart \| Table
Spo24255	0.65	Barchart \| Table
Spo18160	0.65	Barchart \| Table
Spo09949	0.65	Barchart \| Table
Spo21828	0.65	Barchart \| Table
Spo21693	0.65	Barchart \| Table
Spo08073	0.65	Barchart \| Table
Spo25234	0.65	Barchart \| Table
Spo08147	0.65	Barchart \| Table
Spo24594	0.65	Barchart \| Table
Spo10762	0.65	Barchart \| Table