Spo09636 (gene) | SpinachBase

Overview


Name	Spo09636
Type	gene
Organism	Spinacia oleracea (Spinach)
Description	Unknown protein
Location	SpoScf_01319 : 104706 .. 104948 (-)

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGGTTAACAAATCAATTTCCTACCTTTCCAACTCATCACGCGTCATCACCGAAACTTCCGGTCATCCTGCCACTTTTTCTCTCTCCTCCTACTCCTTTTTAATCCCTTCCCCTTCTTTCTCCCACCCATTTTTTCTCACTCAACTGTCAACTCCATTGCAATTTCCAAACGAACAAACATCACCCTTATTATTTTTGTCAAACAAAAAAAAAAATCATAAAATGTCAAAGCAGTTTCCTTAG

mRNA sequence

ATGGTTAACAAATCAATTTCCTACCTTTCCAACTCATCACGCGTCATCACCGAAACTTCCGGTCATCCTGCCACTTTTTCTCTCTCCTCCTACTCCTTTTTAATCCCTTCCCCTTCTTTCTCCCACCCATTTTTTCTCACTCAACTGTCAACTCCATTGCAATTTCCAAACGAACAAACATCACCCTTATTATTTTTGTCAAACAAAAAAAAAAATCATAAAATGTCAAAGCAGTTTCCTTAG

Coding sequence (CDS)

ATGGTTAACAAATCAATTTCCTACCTTTCCAACTCATCACGCGTCATCACCGAAACTTCCGGTCATCCTGCCACTTTTTCTCTCTCCTCCTACTCCTTTTTAATCCCTTCCCCTTCTTTCTCCCACCCATTTTTTCTCACTCAACTGTCAACTCCATTGCAATTTCCAAACGAACAAACATCACCCTTATTATTTTTGTCAAACAAAAAAAAAAATCATAAAATGTCAAAGCAGTTTCCTTAG

Protein sequence

MVNKSISYLSNSSRVITETSGHPATFSLSSYSFLIPSPSFSHPFFLTQLSTPLQFPNEQTSPLLFLSNKKKNHKMSKQFP

Relationships

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Type
Spo09636.1	Spo09636.1	mRNA

Homology

The following BLAST results are available for this feature:

BLAST of Spo09636.1 vs. NCBI nr
BLAST of Spo09636.1 vs. UniProtKB/TrEMBL
BLAST of Spo09636.1 vs. ExPASy Swiss-Prot
BLAST of Spo09636.1 vs. TAIR (Arabidopsis)

BLAST of Spo09636.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo09636.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo09636.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo09636.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

GO Annotation

GO Assignments

This gene is annotated with the following GO terms.

Category	Term Accession	Term Name
biological_process	GO:0016567	protein ubiquitination
biological_process	GO:0009698	phenylpropanoid metabolic process
biological_process	GO:0009862	systemic acquired resistance, salicylic acid mediated signaling pathway
biological_process	GO:0007178	transmembrane receptor protein serine/threonine kinase signaling pathway
biological_process	GO:0006470	protein dephosphorylation
biological_process	GO:0030968	endoplasmic reticulum unfolded protein response
biological_process	GO:0009864	induced systemic resistance, jasmonic acid mediated signaling pathway
biological_process	GO:0008152	metabolic process
biological_process	GO:2000030	regulation of response to red or far red light
biological_process	GO:0010046	response to mycotoxin
biological_process	GO:0052542	defense response by callose deposition
biological_process	GO:0030001	metal ion transport
biological_process	GO:0019722	calcium-mediated signaling
biological_process	GO:0007267	cell-cell signaling
biological_process	GO:0042398	cellular modified amino acid biosynthetic process
biological_process	GO:0006598	polyamine catabolic process
biological_process	GO:0009697	salicylic acid biosynthetic process
biological_process	GO:0048767	root hair elongation
biological_process	GO:0010167	response to nitrate
biological_process	GO:0055114	oxidation-reduction process
biological_process	GO:0015706	nitrate transport
biological_process	GO:0042218	1-aminocyclopropane-1-carboxylate biosynthetic process
biological_process	GO:0006520	cellular amino acid metabolic process
biological_process	GO:0006952	defense response
biological_process	GO:0009693	ethylene biosynthetic process
biological_process	GO:0009835	fruit ripening
biological_process	GO:0009737	response to abscisic acid
biological_process	GO:0010200	response to chitin
biological_process	GO:0009723	response to ethylene
biological_process	GO:0006468	protein phosphorylation
biological_process	GO:0006073	cellular glucan metabolic process
biological_process	GO:0009069	serine family amino acid metabolic process
biological_process	GO:0071555	cell wall organization
biological_process	GO:0010224	response to UV-B
biological_process	GO:0019684	photosynthesis, light reaction
biological_process	GO:0006857	oligopeptide transport
biological_process	GO:0016310	phosphorylation
biological_process	GO:0009741	response to brassinosteroid
biological_process	GO:0009738	abscisic acid-activated signaling pathway
biological_process	GO:0000169	activation of MAPK activity involved in osmosensory signaling pathway
biological_process	GO:0010120	camalexin biosynthetic process
biological_process	GO:0042742	defense response to bacterium
biological_process	GO:0050832	defense response to fungus
biological_process	GO:0001666	response to hypoxia
biological_process	GO:0010229	inflorescence development
biological_process	GO:0009867	jasmonic acid mediated signaling pathway
biological_process	GO:0031348	negative regulation of defense response
biological_process	GO:0043069	negative regulation of programmed cell death
biological_process	GO:0009595	detection of biotic stimulus
biological_process	GO:0009409	response to cold
biological_process	GO:0010363	regulation of plant-type hypersensitive response
biological_process	GO:0006355	regulation of transcription, DNA-templated
biological_process	GO:2000037	regulation of stomatal complex patterning
biological_process	GO:2000038	regulation of stomatal complex development
biological_process	GO:0035304	regulation of protein dephosphorylation
biological_process	GO:0043900	regulation of multi-organism process
biological_process	GO:0048481	plant ovule development
biological_process	GO:0080136	priming of cellular response to stress
biological_process	GO:0010310	regulation of hydrogen peroxide metabolic process
biological_process	GO:0006612	protein targeting to membrane
cellular_component	GO:0005618	cell wall
cellular_component	GO:0005834	heterotrimeric G-protein complex
cellular_component	GO:0000785	chromatin
cellular_component	GO:0008287	protein serine/threonine phosphatase complex
cellular_component	GO:0005737	cytoplasm
cellular_component	GO:0005634	nucleus
cellular_component	GO:0048046	apoplast
cellular_component	GO:0016020	membrane
cellular_component	GO:0016021	integral component of membrane
cellular_component	GO:0009506	plasmodesma
molecular_function	GO:0003682	chromatin binding
molecular_function	GO:0016762	xyloglucan:xyloglucosyl transferase activity
molecular_function	GO:0004674	protein serine/threonine kinase activity
molecular_function	GO:0004722	protein serine/threonine phosphatase activity
molecular_function	GO:0005509	calcium ion binding
molecular_function	GO:0016740	transferase activity
molecular_function	GO:0004672	protein kinase activity
molecular_function	GO:0046872	metal ion binding
molecular_function	GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds
molecular_function	GO:0016874	ligase activity
molecular_function	GO:0005515	protein binding
molecular_function	GO:0004842	ubiquitin-protein transferase activity
molecular_function	GO:0016301	kinase activity
molecular_function	GO:0000166	nucleotide binding
molecular_function	GO:0005524	ATP binding
molecular_function	GO:0004707	MAP kinase activity
molecular_function	GO:0019899	enzyme binding
molecular_function	GO:0016757	transferase activity, transferring glycosyl groups
molecular_function	GO:0030170	pyridoxal phosphate binding
molecular_function	GO:0005179	hormone activity
molecular_function	GO:0004871	obsolete signal transducer activity
molecular_function	GO:0020037	heme binding
molecular_function	GO:0005506	iron ion binding
molecular_function	GO:0016491	oxidoreductase activity
molecular_function	GO:0016847	1-aminocyclopropane-1-carboxylate synthase activity
molecular_function	GO:0042802	identical protein binding
molecular_function	GO:0003677	DNA binding

RNA-Seq Expression

Co-expression


Gene	r value	Expression
Spo26013	0.81	Barchart \| Table
Spo16587	0.78	Barchart \| Table
Spo20174	0.78	Barchart \| Table
Spo26899	0.77	Barchart \| Table
Spo00283	0.76	Barchart \| Table
Spo19217	0.76	Barchart \| Table
Spo05781	0.76	Barchart \| Table
Spo20729	0.75	Barchart \| Table
Spo00172	0.75	Barchart \| Table
Spo04129	0.75	Barchart \| Table
Spo07784	0.74	Barchart \| Table
Spo07077	0.74	Barchart \| Table
Spo23842	0.74	Barchart \| Table
Spo27165	0.74	Barchart \| Table
Spo14294	0.74	Barchart \| Table
Spo09333	0.74	Barchart \| Table
Spo01352	0.73	Barchart \| Table
Spo17713	0.73	Barchart \| Table
Spo00748	0.73	Barchart \| Table
Spo06885	0.73	Barchart \| Table
Spo21525	0.73	Barchart \| Table
Spo23843	0.73	Barchart \| Table
Spo24040	0.72	Barchart \| Table
Spo02454	0.72	Barchart \| Table
Spo03184	0.72	Barchart \| Table
Spo08419	0.72	Barchart \| Table
Spo15866	0.72	Barchart \| Table
Spo16648	0.72	Barchart \| Table
Spo24976	0.72	Barchart \| Table
Spo25787	0.72	Barchart \| Table
Spo24305	0.71	Barchart \| Table
Spo02091	0.71	Barchart \| Table
Spo27162	0.71	Barchart \| Table
Spo12712	0.71	Barchart \| Table
Spo19868	0.71	Barchart \| Table
Spo05046	0.71	Barchart \| Table
Spo14295	0.71	Barchart \| Table
Spo22033	0.71	Barchart \| Table
Spo09334	0.71	Barchart \| Table
Spo02481	0.71	Barchart \| Table
Spo13499	0.70	Barchart \| Table
Spo24818	0.70	Barchart \| Table
Spo07484	0.70	Barchart \| Table
Spo21509	0.70	Barchart \| Table
Spo02548	0.70	Barchart \| Table
Spo03203	0.70	Barchart \| Table
Spo19888	0.70	Barchart \| Table
Spo12719	0.70	Barchart \| Table
Spo23770	0.69	Barchart \| Table
Spo08325	0.69	Barchart \| Table
Spo12145	0.69	Barchart \| Table
Spo04872	0.69	Barchart \| Table
Spo17753	0.69	Barchart \| Table
Spo18383	0.69	Barchart \| Table
Spo21676	0.69	Barchart \| Table
Spo22436	0.69	Barchart \| Table
Spo23852	0.69	Barchart \| Table
Spo00190	0.69	Barchart \| Table
Spo00782	0.69	Barchart \| Table
Spo25350	0.68	Barchart \| Table
Spo11175	0.68	Barchart \| Table
Spo13482	0.68	Barchart \| Table
Spo01629	0.68	Barchart \| Table
Spo23382	0.68	Barchart \| Table
Spo09635	0.68	Barchart \| Table
Spo20562	0.68	Barchart \| Table
Spo10737	0.68	Barchart \| Table
Spo10826	0.68	Barchart \| Table
Spo00611	0.67	Barchart \| Table
Spo07215	0.67	Barchart \| Table
Spo18410	0.67	Barchart \| Table
Spo04379	0.67	Barchart \| Table
Spo09761	0.67	Barchart \| Table
Spo21785	0.67	Barchart \| Table
Spo05402	0.67	Barchart \| Table
Spo22396	0.67	Barchart \| Table
Spo06022	0.67	Barchart \| Table
Spo08034	0.67	Barchart \| Table
Spo05842	0.67	Barchart \| Table
Spo01514	0.67	Barchart \| Table
Spo05464	0.67	Barchart \| Table
Spo24769	0.67	Barchart \| Table
Spo12589	0.67	Barchart \| Table
Spo11193	0.67	Barchart \| Table
Spo13210	0.67	Barchart \| Table
Spo13383	0.67	Barchart \| Table
Spo13518	0.67	Barchart \| Table
Spo10910	0.66	Barchart \| Table
Spo10485	0.66	Barchart \| Table
Spo20292	0.66	Barchart \| Table
Spo05047	0.66	Barchart \| Table
Spo10444	0.66	Barchart \| Table
Spo14719	0.66	Barchart \| Table
Spo26086	0.66	Barchart \| Table
Spo07685	0.66	Barchart \| Table
Spo07236	0.66	Barchart \| Table
Spo14682	0.66	Barchart \| Table
Spo25129	0.66	Barchart \| Table
Spo27031	0.66	Barchart \| Table
Spo14667	0.65	Barchart \| Table
Spo17344	0.65	Barchart \| Table
Spo17631	0.65	Barchart \| Table
Spo16804	0.65	Barchart \| Table
Spo07646	0.65	Barchart \| Table
Spo23853	0.65	Barchart \| Table
Spo15499	0.65	Barchart \| Table
Spo06335	0.65	Barchart \| Table
Spo13583	0.65	Barchart \| Table
Spo11150	0.65	Barchart \| Table