Spo11961 (gene)

Overview
NameSpo11961
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
Locationchr4 : 8485729 .. 8486366 (+)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGAACTCTTGCAAGTTGCAAGACAACGTCTTTGTCATCTCCCCTCTCCGTTCAATTTCAACACTTTCTTTTAATCTGGTTTGTATTCATTTCTTCCTAATTCACGATGATGAAAAGTTTCGAGGTTGGTGTCAAGAGTTTATTGGCTCATGACCGGAACTGCATGAATTGGACTTAAACTCATTTTGAGCTTCACAAGGTTGTTGGATTCGAGCAAATTCTACAACTTATGTTGCTTGTCTGGTGTTGTACTGTCACACAAAGTGTGAGGTGTCAGATTGTTGGACTCTTTTAAGTTATTTTAATAAGCATTTTTTGCTTGCGGATTTATTCAATTTAAGTCTAGGATTTAAGTTATTTCCTGGTCCTAATTGTATTAGGAGGTTTTTTTGCCCTATAACTAGACTTTAATCTTTGTACGAGTACAAGTTTTGGTGTTTTCCCAAATTCAATTTTCCTTATCATTATCGTCGTCGTGTCAATCAAAAACCCTAATTCGTTCCGATTCAATTTCAGCCTCGCAATTTCTCTATCCTCCCCATCTCGATTCCCTCCGCTTTCTCTCTCCTAATTCCGACAACCATCTCCGGCACCGCCTGATCAATCAATCCATCTGCTCATTTATCGATTTCAGATAA

mRNA sequence

ATGAACTCTTGCAAGTTGCAAGACAACGTCTTTGTCATCTCCCCTCTCCGTTCAATTTCAACACTTTCTTTTAATCTGGTTTGTATTCATTTCTTCCTAATTCACGATGATGAAAAGTTTCGAGTACAAGTTTTGGTGTTTTCCCAAATTCAATTTTCCTTATCATTATCGTCGTCGTGTCAATCAAAAACCCTAATTCGTTCCGATTCAATTTCAGCCTCGCAATTTCTCTATCCTCCCCATCTCGATTCCCTCCGCTTTCTCTCTCCTAATTCCGACAACCATCTCCGGCACCGCCTGATCAATCAATCCATCTGCTCATTTATCGATTTCAGATAA

Coding sequence (CDS)

ATGAACTCTTGCAAGTTGCAAGACAACGTCTTTGTCATCTCCCCTCTCCGTTCAATTTCAACACTTTCTTTTAATCTGGTTTGTATTCATTTCTTCCTAATTCACGATGATGAAAAGTTTCGAGTACAAGTTTTGGTGTTTTCCCAAATTCAATTTTCCTTATCATTATCGTCGTCGTGTCAATCAAAAACCCTAATTCGTTCCGATTCAATTTCAGCCTCGCAATTTCTCTATCCTCCCCATCTCGATTCCCTCCGCTTTCTCTCTCCTAATTCCGACAACCATCTCCGGCACCGCCTGATCAATCAATCCATCTGCTCATTTATCGATTTCAGATAA

Protein sequence

MNSCKLQDNVFVISPLRSISTLSFNLVCIHFFLIHDDEKFRVQVLVFSQIQFSLSLSSSCQSKTLIRSDSISASQFLYPPHLDSLRFLSPNSDNHLRHRLINQSICSFIDFR
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo11961.1Spo11961.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo11961.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo11961.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo11961.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo11961.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0016126 sterol biosynthetic process
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0048193 Golgi vesicle transport
biological_process GO:0000902 cell morphogenesis
biological_process GO:0045892 negative regulation of transcription, DNA-templated
biological_process GO:0009555 pollen development
biological_process GO:0042744 hydrogen peroxide catabolic process
biological_process GO:0009793 embryo development ending in seed dormancy
biological_process GO:0009231 riboflavin biosynthetic process
biological_process GO:0006412 translation
biological_process GO:0042254 ribosome biogenesis
biological_process GO:0006354 DNA-templated transcription, elongation
biological_process GO:0009853 photorespiration
biological_process GO:0010431 seed maturation
biological_process GO:0010228 vegetative to reproductive phase transition of meristem
biological_process GO:0006144 purine nucleobase metabolic process
biological_process GO:0009832 plant-type cell wall biogenesis
biological_process GO:0016310 phosphorylation
biological_process GO:0006096 glycolytic process
biological_process GO:0006094 gluconeogenesis
biological_process GO:0030243 cellulose metabolic process
biological_process GO:0016049 cell growth
biological_process GO:0015976 carbon utilization
biological_process GO:0006457 protein folding
biological_process GO:0009773 photosynthetic electron transport in photosystem I
biological_process GO:0006560 proline metabolic process
biological_process GO:0048481 plant ovule development
biological_process GO:0090503 RNA phosphodiester bond hydrolysis, exonucleolytic
biological_process GO:0046487 glyoxylate metabolic process
biological_process GO:0006526 arginine biosynthetic process
biological_process GO:0015995 chlorophyll biosynthetic process
biological_process GO:0019761 glucosinolate biosynthetic process
biological_process GO:0010206 photosystem II repair
biological_process GO:0006636 unsaturated fatty acid biosynthetic process
biological_process GO:0006744 ubiquinone biosynthetic process
biological_process GO:0009744 response to sucrose
biological_process GO:0009644 response to high light intensity
biological_process GO:0010155 regulation of proton transport
biological_process GO:0045893 positive regulation of transcription, DNA-templated
biological_process GO:0006655 phosphatidylglycerol biosynthetic process
biological_process GO:0009965 leaf morphogenesis
biological_process GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
biological_process GO:0019344 cysteine biosynthetic process
biological_process GO:0030154 cell differentiation
biological_process GO:0019375 galactolipid biosynthetic process
biological_process GO:0016117 carotenoid biosynthetic process
biological_process GO:0009073 aromatic amino acid family biosynthetic process
biological_process GO:0035304 regulation of protein dephosphorylation
biological_process GO:0006508 proteolysis
biological_process GO:0006771 riboflavin metabolic process
biological_process GO:0042967 obsolete acyl-carrier-protein biosynthetic process
biological_process GO:0019048 modulation by virus of host morphology or physiology
biological_process GO:0010027 thylakoid membrane organization
biological_process GO:0010264 myo-inositol hexakisphosphate biosynthetic process
biological_process GO:0009734 auxin-activated signaling pathway
biological_process GO:0016036 cellular response to phosphate starvation
biological_process GO:0016311 dephosphorylation
biological_process GO:0006591 ornithine metabolic process
biological_process GO:0006164 purine nucleotide biosynthetic process
biological_process GO:0019497 hexachlorocyclohexane metabolic process
biological_process GO:0006635 fatty acid beta-oxidation
biological_process GO:0046777 protein autophosphorylation
biological_process GO:0018108 peptidyl-tyrosine phosphorylation
biological_process GO:0015991 ATP hydrolysis coupled proton transport
biological_process GO:0006574 valine catabolic process
biological_process GO:0006568 tryptophan metabolic process
biological_process GO:0006554 lysine catabolic process
biological_process GO:0046251 limonene catabolic process
biological_process GO:0006552 leucine catabolic process
biological_process GO:0006550 isoleucine catabolic process
biological_process GO:0006633 fatty acid biosynthetic process
biological_process GO:0019482 beta-alanine metabolic process
biological_process GO:0006446 regulation of translational initiation
biological_process GO:0018874 benzoate metabolic process
biological_process GO:0007033 vacuole organization
biological_process GO:0055085 transmembrane transport
biological_process GO:0009651 response to salt stress
biological_process GO:1902600 proton transmembrane transport
biological_process GO:0006623 protein targeting to vacuole
biological_process GO:0007030 Golgi organization
biological_process GO:0006007 glucose catabolic process
biological_process GO:0006816 calcium ion transport
biological_process GO:0008152 metabolic process
biological_process GO:0009069 serine family amino acid metabolic process
biological_process GO:0009816 defense response to bacterium, incompatible interaction
biological_process GO:0015979 photosynthesis
biological_process GO:0006468 protein phosphorylation
biological_process GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
biological_process GO:0006098 pentose-phosphate shunt
biological_process GO:0010207 photosystem II assembly
biological_process GO:0050896 response to stimulus
biological_process GO:0009657 plastid organization
biological_process GO:0009637 response to blue light
biological_process GO:0010218 response to far red light
biological_process GO:0010114 response to red light
biological_process GO:0006897 endocytosis
biological_process GO:0006364 rRNA processing
cellular_component GO:0009570 chloroplast stroma
cellular_component GO:0009348 ornithine carbamoyltransferase complex
cellular_component GO:0005794 Golgi apparatus
cellular_component GO:0000325 plant-type vacuole
cellular_component GO:0005886 plasma membrane
cellular_component GO:0005774 vacuolar membrane
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0009941 chloroplast envelope
cellular_component GO:0005747 mitochondrial respiratory chain complex I
cellular_component GO:0005840 ribosome
cellular_component GO:0009523 photosystem II
cellular_component GO:0005789 endoplasmic reticulum membrane
cellular_component GO:0045277 respiratory chain complex IV
cellular_component GO:0031977 thylakoid lumen
cellular_component GO:0009507 chloroplast
cellular_component GO:0044425 membrane part
cellular_component GO:0005783 endoplasmic reticulum
cellular_component GO:0005777 peroxisome
cellular_component GO:0033179 proton-transporting V-type ATPase, V0 domain
cellular_component GO:0005634 nucleus
cellular_component GO:0005746 mitochondrial respiratory chain
cellular_component GO:0005737 cytoplasm
cellular_component GO:0009535 chloroplast thylakoid membrane
molecular_function GO:0005198 structural molecule activity
molecular_function GO:0004129 cytochrome-c oxidase activity
molecular_function GO:0003743 translation initiation factor activity
molecular_function GO:0008531 riboflavin kinase activity
molecular_function GO:0003919 FMN adenylyltransferase activity
molecular_function GO:0008967 phosphoglycolate phosphatase activity
molecular_function GO:0015078 proton transmembrane transporter activity
molecular_function GO:0003993 acid phosphatase activity
molecular_function GO:0047617 acyl-CoA hydrolase activity
molecular_function GO:0000287 magnesium ion binding
molecular_function GO:0008685 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity
molecular_function GO:0005506 iron ion binding
molecular_function GO:0005515 protein binding
molecular_function GO:0042626 ATPase activity, coupled to transmembrane movement of substances
molecular_function GO:0051750 delta3,5-delta2,4-dienoyl-CoA isomerase activity
molecular_function GO:0004300 enoyl-CoA hydratase activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0004715 non-membrane spanning protein tyrosine kinase activity
molecular_function GO:0004674 protein serine/threonine kinase activity
molecular_function GO:0031072 heat shock protein binding
molecular_function GO:0051082 unfolded protein binding
molecular_function GO:0005525 GTP binding
molecular_function GO:0016746 transferase activity, transferring acyl groups
molecular_function GO:0004672 protein kinase activity
molecular_function GO:0016597 amino acid binding
molecular_function GO:0004222 metalloendopeptidase activity
molecular_function GO:0004585 ornithine carbamoyltransferase activity
molecular_function GO:0030955 potassium ion binding
molecular_function GO:0004743 pyruvate kinase activity
molecular_function GO:0003735 structural constituent of ribosome
molecular_function GO:0008270 zinc ion binding
molecular_function GO:0046872 metal ion binding
molecular_function GO:0004535 poly(A)-specific ribonuclease activity
molecular_function GO:0003723 RNA binding
molecular_function GO:0016740 transferase activity
molecular_function GO:0046983 protein dimerization activity
molecular_function GO:0003677 DNA binding
molecular_function GO:0008080 N-acetyltransferase activity
molecular_function GO:0016787 hydrolase activity
RNA-Seq Expression
   



Co-expression
Gener valueExpression
Spo050730.80Barchart | Table
Spo280580.79Barchart | Table
Spo201520.78Barchart | Table
Spo175780.78Barchart | Table
Spo130290.77Barchart | Table
Spo037360.76Barchart | Table
Spo064730.76Barchart | Table
Spo205440.76Barchart | Table
Spo208690.76Barchart | Table
Spo210670.76Barchart | Table
Spo012610.75Barchart | Table
Spo270810.75Barchart | Table
Spo088500.75Barchart | Table
Spo062930.74Barchart | Table
Spo092900.74Barchart | Table
Spo248570.74Barchart | Table
Spo060040.74Barchart | Table
Spo228110.74Barchart | Table
Spo140870.74Barchart | Table
Spo029320.73Barchart | Table
Spo018580.73Barchart | Table
Spo256390.73Barchart | Table
Spo146780.73Barchart | Table
Spo210460.72Barchart | Table
Spo108640.72Barchart | Table
Spo048380.72Barchart | Table
Spo192450.72Barchart | Table
Spo051350.72Barchart | Table
Spo054310.72Barchart | Table
Spo109400.71Barchart | Table
Spo185750.71Barchart | Table
Spo144160.71Barchart | Table
Spo197380.71Barchart | Table
Spo025730.71Barchart | Table
Spo004980.71Barchart | Table
Spo239070.71Barchart | Table
Spo251590.71Barchart | Table
Spo074760.71Barchart | Table
Spo093350.71Barchart | Table
Spo014260.70Barchart | Table
Spo123760.70Barchart | Table
Spo156390.70Barchart | Table
Spo125890.70Barchart | Table
Spo283240.69Barchart | Table
Spo024840.69Barchart | Table
Spo087130.69Barchart | Table
Spo117330.69Barchart | Table
Spo133930.69Barchart | Table
Spo134900.69Barchart | Table
Spo135180.69Barchart | Table
Spo139050.69Barchart | Table
Spo146670.69Barchart | Table
Spo153720.69Barchart | Table
Spo158730.69Barchart | Table
Spo172090.69Barchart | Table
Spo187820.69Barchart | Table
Spo205210.69Barchart | Table
Spo225290.69Barchart | Table
Spo254830.69Barchart | Table
Spo258760.69Barchart | Table
Spo271020.69Barchart | Table
Spo147790.68Barchart | Table
Spo149420.68Barchart | Table
Spo261170.68Barchart | Table
Spo043830.68Barchart | Table
Spo046530.68Barchart | Table
Spo049080.68Barchart | Table
Spo179890.68Barchart | Table
Spo169960.68Barchart | Table
Spo267680.68Barchart | Table
Spo173230.68Barchart | Table
Spo049960.68Barchart | Table
Spo216600.68Barchart | Table
Spo102350.68Barchart | Table
Spo115090.68Barchart | Table
Spo230580.68Barchart | Table
Spo109230.68Barchart | Table
Spo037570.68Barchart | Table
Spo108150.68Barchart | Table
Spo103160.68Barchart | Table
Spo119230.67Barchart | Table
Spo069490.67Barchart | Table
Spo253900.67Barchart | Table
Spo003440.67Barchart | Table
Spo017270.67Barchart | Table
Spo139520.67Barchart | Table
Spo067970.67Barchart | Table
Spo142250.67Barchart | Table
Spo143420.67Barchart | Table
Spo260450.67Barchart | Table
Spo057280.67Barchart | Table
Spo176100.67Barchart | Table
Spo181950.67Barchart | Table
Spo040820.67Barchart | Table
Spo031950.67Barchart | Table
Spo211550.67Barchart | Table
Spo016860.67Barchart | Table
Spo020100.67Barchart | Table
Spo123020.67Barchart | Table
Spo076190.66Barchart | Table
Spo050930.66Barchart | Table
Spo242980.66Barchart | Table
Spo253470.66Barchart | Table
Spo019290.66Barchart | Table
Spo252300.66Barchart | Table
Spo096050.66Barchart | Table
Spo128940.66Barchart | Table
Spo049070.66Barchart | Table
Spo089690.66Barchart | Table
Spo174450.66Barchart | Table
Spo123700.66Barchart | Table
Spo176790.66Barchart | Table
Spo160790.66Barchart | Table
Spo089700.66Barchart | Table
Spo268580.66Barchart | Table
Spo270620.66Barchart | Table
Spo113170.66Barchart | Table
Spo206860.66Barchart | Table
Spo114420.66Barchart | Table
Spo114460.66Barchart | Table
Spo006670.66Barchart | Table
Spo217310.66Barchart | Table
Spo131840.66Barchart | Table
Spo238570.66Barchart | Table
Spo240460.66Barchart | Table
Spo240680.66Barchart | Table
Spo156300.65Barchart | Table
Spo201870.65Barchart | Table
Spo102850.65Barchart | Table
Spo021860.65Barchart | Table
Spo176120.65Barchart | Table
Spo057310.65Barchart | Table
Spo032550.65Barchart | Table
Spo264300.65Barchart | Table
Spo242870.65Barchart | Table
Spo100110.65Barchart | Table
Spo248080.65Barchart | Table
Spo123640.65Barchart | Table
Spo022860.65Barchart | Table
Spo095540.65Barchart | Table