Spo13210 (gene)

Overview
NameSpo13210
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
LocationSpoScf_01451 : 83647 .. 84003 (+)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGCAGAATCAATCCTATCAAATTCCGGCAAGGCTCCACCAAGTCCGGCCACCGTGAACGACGGAGAAGATGCCGTGGAGATCCGTCAATCAAAGAAGAGGAAAAACTGCCCAACTTTCTCTCTTCTTCAATTGAACAAAAAACTTATTGATGGGCAATCAAATTCAAGCTTTACCTTCTCTTTCCCCACTGATGAACTCACTACCACGACTCCCGATGTGACTCCCAAATTCGGATTCTTCAATTCGGGTAAGGATACGAGTACTGGGTTGTCGTCGGAAAGTGGCCGTTCTTGTCAAGCTCCAGCGAAGAACAGCGAGGGAATTACAGCGGTTGAAGAAGCTGACAAGATTTGA

mRNA sequence

ATGGCAGAATCAATCCTATCAAATTCCGGCAAGGCTCCACCAAGTCCGGCCACCGTGAACGACGGAGAAGATGCCGTGGAGATCCGTCAATCAAAGAAGAGGAAAAACTGCCCAACTTTCTCTCTTCTTCAATTGAACAAAAAACTTATTGATGGGCAATCAAATTCAAGCTTTACCTTCTCTTTCCCCACTGATGAACTCACTACCACGACTCCCGATGTGACTCCCAAATTCGGATTCTTCAATTCGGGTAAGGATACGAGTACTGGGTTGTCGTCGGAAAGTGGCCGTTCTTGTCAAGCTCCAGCGAAGAACAGCGAGGGAATTACAGCGGTTGAAGAAGCTGACAAGATTTGA

Coding sequence (CDS)

ATGGCAGAATCAATCCTATCAAATTCCGGCAAGGCTCCACCAAGTCCGGCCACCGTGAACGACGGAGAAGATGCCGTGGAGATCCGTCAATCAAAGAAGAGGAAAAACTGCCCAACTTTCTCTCTTCTTCAATTGAACAAAAAACTTATTGATGGGCAATCAAATTCAAGCTTTACCTTCTCTTTCCCCACTGATGAACTCACTACCACGACTCCCGATGTGACTCCCAAATTCGGATTCTTCAATTCGGGTAAGGATACGAGTACTGGGTTGTCGTCGGAAAGTGGCCGTTCTTGTCAAGCTCCAGCGAAGAACAGCGAGGGAATTACAGCGGTTGAAGAAGCTGACAAGATTTGA

Protein sequence

MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTFSFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo13210.1Spo13210.1mRNA


Homology
[Close]
BLAST of Spo13210.1 vs. NCBI nr
Match: gi|902155097|gb|KNA05876.1| (hypothetical protein SOVF_186330 [Spinacia oleracea])

HSP 1 Score: 228.8 bits (582), Expect = 5.000e-57
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1 

		  

Query: 1   MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF 60
           MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF
Sbjct: 1   MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF 60

Query: 61  SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI 119
           SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI
Sbjct: 61  SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI 118
[Close]
BLAST of Spo13210.1 vs. NCBI nr
Match: gi|870864128|gb|KMT15261.1| (hypothetical protein BVRB_3g063700 [Beta vulgaris subsp. vulgaris])

HSP 1 Score: 105.9 bits (263), Expect = 4.900e-20
Identity = 57/82 (69.51%), Postives = 66/82 (80.49%), Query Frame = 1 

		  

Query: 7   SNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTFSFPTDE 66
           S+SGK P   AT+   +D VE R+SK+RKNCP+FSLLQL  K+IDGQSNSSF FSFPTDE
Sbjct: 31  SDSGKPPSIRATI---DDVVETRKSKRRKNCPSFSLLQL-NKIIDGQSNSSFNFSFPTDE 90

Query: 67  LTTTTPDVTPKFGFFNSGKDTS 89
           LTTTTP+ TPKFG FNSG  +S
Sbjct: 91  LTTTTPETTPKFGSFNSGHGSS 108
[Close]
BLAST of Spo13210.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QH23_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_186330 PE=4 SV=1)

HSP 1 Score: 228.8 bits (582), Expect = 3.500e-57
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1 

		  

Query: 1   MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF 60
           MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF
Sbjct: 1   MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF 60

Query: 61  SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI 119
           SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI
Sbjct: 61  SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI 118
[Close]
BLAST of Spo13210.1 vs. UniProtKB/TrEMBL
Match: A0A0J8FH80_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_3g063700 PE=4 SV=1)

HSP 1 Score: 105.9 bits (263), Expect = 3.400e-20
Identity = 57/82 (69.51%), Postives = 66/82 (80.49%), Query Frame = 1 

		  

Query: 7   SNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTFSFPTDE 66
           S+SGK P   AT+   +D VE R+SK+RKNCP+FSLLQL  K+IDGQSNSSF FSFPTDE
Sbjct: 31  SDSGKPPSIRATI---DDVVETRKSKRRKNCPSFSLLQL-NKIIDGQSNSSFNFSFPTDE 90

Query: 67  LTTTTPDVTPKFGFFNSGKDTS 89
           LTTTTP+ TPKFG FNSG  +S
Sbjct: 91  LTTTTPETTPKFGSFNSGHGSS 108
The following BLAST results are available for this feature:
BLAST of Spo13210.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 2
Match NameE-valueIdentityDescription
gi|902155097|gb|KNA05876.1|5.0e-57100.hypothetical protein SOVF_1863... [more]
gi|870864128|gb|KMT15261.1|4.9e-2069.5hypothetical protein BVRB_3g06... [more]
back to top
BLAST of Spo13210.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A0K9QH23_SPIOL3.5e-57100.Uncharacterized protein OS=Spi... [more]
A0A0J8FH80_BETVU3.4e-2069.5Uncharacterized protein OS=Bet... [more]
back to top
BLAST of Spo13210.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo13210.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
biological_process GO:0009737 response to abscisic acid
biological_process GO:0000902 cell morphogenesis
biological_process GO:0016049 cell growth
biological_process GO:0048767 root hair elongation
biological_process GO:0007267 cell-cell signaling
biological_process GO:0019722 calcium-mediated signaling
biological_process GO:0010951 negative regulation of endopeptidase activity
biological_process GO:0008152 metabolic process
biological_process GO:0009555 pollen development
biological_process GO:0042744 hydrogen peroxide catabolic process
biological_process GO:0009793 embryo development ending in seed dormancy
biological_process GO:0006906 vesicle fusion
biological_process GO:0010118 stomatal movement
biological_process GO:0009651 response to salt stress
biological_process GO:0010363 regulation of plant-type hypersensitive response
biological_process GO:0007033 vacuole organization
biological_process GO:0006612 protein targeting to membrane
biological_process GO:0009963 positive regulation of flavonoid biosynthetic process
biological_process GO:0006598 polyamine catabolic process
biological_process GO:0009698 phenylpropanoid metabolic process
biological_process GO:0046909 obsolete intermembrane transport
biological_process GO:0006887 exocytosis
biological_process GO:0042398 cellular modified amino acid biosynthetic process
biological_process GO:0006816 calcium ion transport
biological_process GO:0006412 translation
biological_process GO:0042254 ribosome biogenesis
biological_process GO:0030488 tRNA methylation
biological_process GO:0006470 protein dephosphorylation
biological_process GO:0080005 photosystem stoichiometry adjustment
biological_process GO:0009767 photosynthetic electron transport chain
biological_process GO:0090503 RNA phosphodiester bond hydrolysis, exonucleolytic
biological_process GO:0010228 vegetative to reproductive phase transition of meristem
biological_process GO:0009616 virus induced gene silencing
biological_process GO:0044262 cellular carbohydrate metabolic process
biological_process GO:0032482 Rab protein signal transduction
biological_process GO:0006623 protein targeting to vacuole
biological_process GO:0006888 ER to Golgi vesicle-mediated transport
biological_process GO:0006446 regulation of translational initiation
biological_process GO:0009611 response to wounding
biological_process GO:0009753 response to jasmonic acid
biological_process GO:0009620 response to fungus
biological_process GO:0006508 proteolysis
biological_process GO:0009695 jasmonic acid biosynthetic process
biological_process GO:0009738 abscisic acid-activated signaling pathway
biological_process GO:0043069 negative regulation of programmed cell death
biological_process GO:0030968 endoplasmic reticulum unfolded protein response
biological_process GO:0052542 defense response by callose deposition
biological_process GO:0009987 cellular process
biological_process GO:0005975 carbohydrate metabolic process
biological_process GO:0015994 chlorophyll metabolic process
biological_process GO:0051090 regulation of DNA-binding transcription factor activity
biological_process GO:0015991 ATP hydrolysis coupled proton transport
biological_process GO:0006614 SRP-dependent cotranslational protein targeting to membrane
biological_process GO:0045900 negative regulation of translational elongation
biological_process GO:0032940 secretion by cell
biological_process GO:0006913 nucleocytoplasmic transport
biological_process GO:0006891 intra-Golgi vesicle-mediated transport
biological_process GO:0006979 response to oxidative stress
biological_process GO:0030091 protein repair
biological_process GO:0006464 cellular protein modification process
biological_process GO:0045454 cell redox homeostasis
biological_process GO:0010024 phytochromobilin biosynthetic process
biological_process GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
biological_process GO:0006788 heme oxidation
biological_process GO:0010051 xylem and phloem pattern formation
biological_process GO:0007030 Golgi organization
biological_process GO:0010050 vegetative phase change
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0009734 auxin-activated signaling pathway
biological_process GO:0010207 photosystem II assembly
biological_process GO:0070676 intralumenal vesicle formation
biological_process GO:0010158 abaxial cell fate specification
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0006223 uracil salvage
biological_process GO:0016573 histone acetylation
biological_process GO:0042967 obsolete acyl-carrier-protein biosynthetic process
biological_process GO:0044206 UMP salvage
biological_process GO:0030244 cellulose biosynthetic process
biological_process GO:0032502 developmental process
biological_process GO:0007034 vacuolar transport
biological_process GO:0006629 lipid metabolic process
biological_process GO:0042542 response to hydrogen peroxide
biological_process GO:0009644 response to high light intensity
biological_process GO:0010200 response to chitin
biological_process GO:0007264 small GTPase mediated signal transduction
biological_process GO:0048193 Golgi vesicle transport
biological_process GO:0015031 protein transport
biological_process GO:0009850 auxin metabolic process
biological_process GO:0009887 animal organ morphogenesis
biological_process GO:0061025 membrane fusion
biological_process GO:0046339 diacylglycerol metabolic process
biological_process GO:0016042 lipid catabolic process
biological_process GO:0031047 gene silencing by RNA
biological_process GO:0006886 intracellular protein transport
biological_process GO:0048519 negative regulation of biological process
biological_process GO:0035556 intracellular signal transduction
biological_process GO:0048439 flower morphogenesis
biological_process GO:0048438 floral whorl development
biological_process GO:0016556 mRNA modification
biological_process GO:0010582 floral meristem determinacy
biological_process GO:0009855 determination of bilateral symmetry
biological_process GO:0046686 response to cadmium ion
biological_process GO:0009395 phospholipid catabolic process
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0005789 endoplasmic reticulum membrane
cellular_component GO:0009507 chloroplast
cellular_component GO:0005773 vacuole
cellular_component GO:0044464 cell part
cellular_component GO:0005667 transcription factor complex
cellular_component GO:0000123 histone acetyltransferase complex
cellular_component GO:0009536 plastid
cellular_component GO:0016020 membrane
cellular_component GO:0009941 chloroplast envelope
cellular_component GO:0005768 endosome
cellular_component GO:0000139 Golgi membrane
cellular_component GO:0005802 trans-Golgi network
cellular_component GO:0009523 photosystem II
cellular_component GO:0005786 signal recognition particle, endoplasmic reticulum targeting
cellular_component GO:0009535 chloroplast thylakoid membrane
cellular_component GO:0033179 proton-transporting V-type ATPase, V0 domain
cellular_component GO:0005794 Golgi apparatus
cellular_component GO:0000785 chromatin
cellular_component GO:0032040 small-subunit processome
cellular_component GO:0048046 apoplast
cellular_component GO:0005737 cytoplasm
cellular_component GO:0005840 ribosome
cellular_component GO:0005829 cytosol
cellular_component GO:0031201 SNARE complex
cellular_component GO:0005774 vacuolar membrane
cellular_component GO:0009579 thylakoid
cellular_component GO:0031515 tRNA (m1A) methyltransferase complex
cellular_component GO:0005771 multivesicular body
cellular_component GO:0000815 ESCRT III complex
cellular_component GO:0008287 protein serine/threonine phosphatase complex
cellular_component GO:0005730 nucleolus
cellular_component GO:0005886 plasma membrane
cellular_component GO:0009534 chloroplast thylakoid
cellular_component GO:0005634 nucleus
cellular_component GO:0005795 Golgi stack
cellular_component GO:0009506 plasmodesma
cellular_component GO:0009570 chloroplast stroma
molecular_function GO:0003682 chromatin binding
molecular_function GO:0043565 sequence-specific DNA binding
molecular_function GO:0016429 tRNA (adenine-N1-)-methyltransferase activity
molecular_function GO:0016757 transferase activity, transferring glycosyl groups
molecular_function GO:0097159 organic cyclic compound binding
molecular_function GO:1901363 heterocyclic compound binding
molecular_function GO:0004722 protein serine/threonine phosphatase activity
molecular_function GO:0005179 hormone activity
molecular_function GO:0016788 hydrolase activity, acting on ester bonds
molecular_function GO:0046872 metal ion binding
molecular_function GO:0003735 structural constituent of ribosome
molecular_function GO:0004435 phosphatidylinositol phospholipase C activity
molecular_function GO:0004871 obsolete signal transducer activity
molecular_function GO:0008234 cysteine-type peptidase activity
molecular_function GO:0003700 DNA-binding transcription factor activity
molecular_function GO:0003743 translation initiation factor activity
molecular_function GO:0003677 DNA binding
molecular_function GO:0004672 protein kinase activity
molecular_function GO:0005515 protein binding
molecular_function GO:0016787 hydrolase activity
molecular_function GO:0046982 protein heterodimerization activity
molecular_function GO:0004402 histone acetyltransferase activity
molecular_function GO:0004535 poly(A)-specific ribonuclease activity
molecular_function GO:0003723 RNA binding
molecular_function GO:0016740 transferase activity
molecular_function GO:0031072 heat shock protein binding
molecular_function GO:0008233 peptidase activity
molecular_function GO:0004869 cysteine-type endopeptidase inhibitor activity
molecular_function GO:0008270 zinc ion binding
molecular_function GO:0004392 heme oxygenase (decyclizing) activity
molecular_function GO:0003712 transcription coregulator activity
molecular_function GO:0016874 ligase activity
molecular_function GO:0008430 selenium binding
molecular_function GO:0008113 peptide-methionine (S)-S-oxide reductase activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0000149 SNARE binding
molecular_function GO:0005484 SNAP receptor activity
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005509 calcium ion binding
molecular_function GO:0005525 GTP binding
molecular_function GO:0004845 uracil phosphoribosyltransferase activity
molecular_function GO:0008312 7S RNA binding
molecular_function GO:0005047 signal recognition particle binding
molecular_function GO:0010181 FMN binding
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0051082 unfolded protein binding
molecular_function GO:0015078 proton transmembrane transporter activity
molecular_function GO:0019003 GDP binding
RNA-Seq Expression
   



Co-expression
Gener valueExpression
Spo115240.81Barchart | Table
Spo041420.77Barchart | Table
Spo201060.76Barchart | Table
Spo119510.76Barchart | Table
Spo233820.76Barchart | Table
Spo115090.76Barchart | Table
Spo260130.74Barchart | Table
Spo044330.74Barchart | Table
Spo232490.74Barchart | Table
Spo097690.74Barchart | Table
Spo063350.74Barchart | Table
Spo137830.74Barchart | Table
Spo007480.73Barchart | Table
Spo094990.73Barchart | Table
Spo125890.73Barchart | Table
Spo024540.73Barchart | Table
Spo258170.73Barchart | Table
Spo025130.73Barchart | Table
Spo068850.73Barchart | Table
Spo006670.73Barchart | Table
Spo171610.72Barchart | Table
Spo199380.72Barchart | Table
Spo188280.72Barchart | Table
Spo153900.72Barchart | Table
Spo039030.72Barchart | Table
Spo257870.72Barchart | Table
Spo049410.72Barchart | Table
Spo002830.72Barchart | Table
Spo260450.71Barchart | Table
Spo233840.71Barchart | Table
Spo054020.71Barchart | Table
Spo123020.71Barchart | Table
Spo172500.71Barchart | Table
Spo218330.71Barchart | Table
Spo229990.71Barchart | Table
Spo122280.70Barchart | Table
Spo002050.70Barchart | Table
Spo015750.70Barchart | Table
Spo142320.70Barchart | Table
Spo101710.70Barchart | Table
Spo209520.70Barchart | Table
Spo131800.70Barchart | Table
Spo132810.69Barchart | Table
Spo163610.69Barchart | Table
Spo169960.69Barchart | Table
Spo263550.69Barchart | Table
Spo003620.69Barchart | Table
Spo031950.69Barchart | Table
Spo041040.69Barchart | Table
Spo057810.69Barchart | Table
Spo072360.69Barchart | Table
Spo091490.69Barchart | Table
Spo232860.69Barchart | Table
Spo271620.69Barchart | Table
Spo209120.69Barchart | Table
Spo228110.69Barchart | Table
Spo147790.69Barchart | Table
Spo149140.69Barchart | Table
Spo214460.69Barchart | Table
Spo229980.68Barchart | Table
Spo237120.68Barchart | Table
Spo238180.68Barchart | Table
Spo008720.68Barchart | Table
Spo119110.68Barchart | Table
Spo089970.68Barchart | Table
Spo010680.68Barchart | Table
Spo087830.68Barchart | Table
Spo077780.68Barchart | Table
Spo240680.68Barchart | Table
Spo060040.68Barchart | Table
Spo131710.68Barchart | Table
Spo242690.68Barchart | Table
Spo154990.68Barchart | Table
Spo201740.68Barchart | Table
Spo029470.68Barchart | Table
Spo190350.68Barchart | Table
Spo224510.68Barchart | Table
Spo103160.68Barchart | Table
Spo097520.68Barchart | Table
Spo108640.68Barchart | Table
Spo176120.68Barchart | Table
Spo111930.68Barchart | Table
Spo094280.68Barchart | Table
Spo273520.67Barchart | Table
Spo004050.67Barchart | Table
Spo008400.67Barchart | Table
Spo012610.67Barchart | Table
Spo024800.67Barchart | Table
Spo026480.67Barchart | Table
Spo063980.67Barchart | Table
Spo096360.67Barchart | Table
Spo108950.67Barchart | Table
Spo116880.67Barchart | Table
Spo121300.67Barchart | Table
Spo123700.67Barchart | Table
Spo174970.67Barchart | Table
Spo192170.67Barchart | Table
Spo192880.67Barchart | Table
Spo211590.67Barchart | Table
Spo215250.67Barchart | Table
Spo232830.67Barchart | Table
Spo235040.67Barchart | Table
Spo256590.67Barchart | Table
Spo269860.67Barchart | Table
Spo270810.67Barchart | Table
Spo043730.66Barchart | Table
Spo226660.66Barchart | Table
Spo026960.66Barchart | Table
Spo018010.66Barchart | Table
Spo198630.66Barchart | Table
Spo181110.66Barchart | Table
Spo173380.66Barchart | Table
Spo165870.66Barchart | Table
Spo207700.66Barchart | Table
Spo150840.66Barchart | Table
Spo135830.66Barchart | Table
Spo149380.66Barchart | Table
Spo013050.66Barchart | Table
Spo232350.66Barchart | Table
Spo146670.66Barchart | Table
Spo220540.66Barchart | Table
Spo102620.66Barchart | Table
Spo233320.66Barchart | Table
Spo223920.66Barchart | Table
Spo093870.66Barchart | Table
Spo001140.66Barchart | Table
Spo093170.66Barchart | Table
Spo211550.66Barchart | Table
Spo069530.66Barchart | Table
Spo048680.66Barchart | Table
Spo002140.66Barchart | Table
Spo046530.66Barchart | Table
Spo154610.65Barchart | Table
Spo261680.65Barchart | Table
Spo143500.65Barchart | Table
Spo114310.65Barchart | Table
Spo111960.65Barchart | Table
Spo105850.65Barchart | Table
Spo272030.65Barchart | Table
Spo097980.65Barchart | Table
Spo090080.65Barchart | Table
Spo184780.65Barchart | Table