Spo13281 (gene) | SpinachBase

Overview


Name	Spo13281
Type	gene
Organism	Spinacia oleracea (Spinach)
Description	Concanavalin A-like lectin protein kinase family protein
Location	chr2 : 14962247 .. 14962957 (-)

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGAGCTCCGGGATTAATACCGATCAAGCCGTTCGGGTTGTCGACATAGCATTGCTTTGTACCTTGCCCGAGAACAATGGAAGGCCAAAAACGGATGAAATAGTAACGTTCTTGACCACGGACAGCCTCTTACCGCAACTGCCTCCAAATCGGCCTATTGTGTTGTTTCCGTACAATAGCGGCCCTCATATATGCGGAGGTTATGCCTGTGCTCCCTTCGGCTAAAGATCGAGGACACCAGCATACGAAAGAATTGTGTAAACATAAATTAGAGGAACCATTTTTTTGCATTTAGAAAAACAGTACTATTTGGTTGTAAATACTTGCTGTAAGTATAAAATGCTTGGACAAATCACAAAACTTCTCTTAAAACGAGAAACTATAGAGTATTGACCAGCTGAATAGTATACACACATGAAACTTAAAAGCACATCAGAAATGTTCACACTACTGAATTACTGGTTTGCAGCAGCAAATAAACATTTCAATTCCCAAGTACTTTAAACATTTCAATCAAGAGGAACGGAGAGCACGCAATTAAAACTGATCTGAAGATTCATTCAACTCTACATACGCGTTCCAAAGAAATGTATATCAATTTAAATATAAAGAGTGCGCATTGCTGAAAGAAGCTCTAGTACAGCTTTGATTCTTATAGAAAATCCATATAATCCAAAATTCAAGAAACAAGAGACAAAAAACTTAAGCTAA

mRNA sequence

ATGAGCTCCGGGATTAATACCGATCAAGCCGTTCGGGTTGTCGACATAGCATTGCTTTGTACCTTGCCCGAGAACAATGGAAGGCCAAAAACGGATGAAATAGTAACGTTCTTGACCACGGACAGCCTCTTACCGCAACTGCCTCCAAATCGGCCTATTGTGTTGTTTCCGTACAATAGCGGCCCTCATATATGCGGAGTGCGCATTGCTGAAAGAAGCTCTAGTACAGCTTTGATTCTTATAGAAAATCCATATAATCCAAAATTCAAGAAACAAGAGACAAAAAACTTAAGCTAA

Coding sequence (CDS)

ATGAGCTCCGGGATTAATACCGATCAAGCCGTTCGGGTTGTCGACATAGCATTGCTTTGTACCTTGCCCGAGAACAATGGAAGGCCAAAAACGGATGAAATAGTAACGTTCTTGACCACGGACAGCCTCTTACCGCAACTGCCTCCAAATCGGCCTATTGTGTTGTTTCCGTACAATAGCGGCCCTCATATATGCGGAGTGCGCATTGCTGAAAGAAGCTCTAGTACAGCTTTGATTCTTATAGAAAATCCATATAATCCAAAATTCAAGAAACAAGAGACAAAAAACTTAAGCTAA

Protein sequence

MSSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTDSLLPQLPPNRPIVLFPYNSGPHICGVRIAERSSSTALILIENPYNPKFKKQETKNLS

Relationships

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Type
Spo13281.1	Spo13281.1	mRNA

Homology

[Close]

BLAST of Spo13281.1 vs. NCBI nr
Match: gi|902160300|gb|KNA06417.1| (hypothetical protein SOVF_181320 [Spinacia oleracea])

HSP 1 Score: 134.4 bits (337), Expect = 1.100e-28
Identity = 63/66 (95.45%), Postives = 64/66 (96.97%), Query Frame = 1

		  
Query: 1   MSSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTDSLLPQLPPNRPIVLFPYNS 60
           M SGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTT SLLPQLPPNRPIVLFPYNS
Sbjct: 580 MGSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTVSLLPQLPPNRPIVLFPYNS 639

Query: 61  GPHICG 67
           GPH+CG
Sbjct: 640 GPHLCG 645

[Close]

BLAST of Spo13281.1 vs. NCBI nr
Match: gi|731321328|ref|XP_010671293.1| (PREDICTED: probable L-type lectin-domain containing receptor kinase S.7 [Beta vulgaris subsp. vulgaris])

HSP 1 Score: 118.2 bits (295), Expect = 7.900e-24
Identity = 52/66 (78.79%), Postives = 61/66 (92.42%), Query Frame = 1

		  
Query: 1   MSSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTDSLLPQLPPNRPIVLFPYNS 60
           M S ++T+QA+RV+DIALLCTLPENNGRPK +EIVTFLT D +LP+LPPNRPIVLFPYNS
Sbjct: 618 MGSIVDTNQALRVIDIALLCTLPENNGRPKMEEIVTFLTMDCILPELPPNRPIVLFPYNS 677

Query: 61  GPHICG 67
           GPH+CG
Sbjct: 678 GPHLCG 683

[Close]

BLAST of Spo13281.1 vs. NCBI nr
Match: gi|914726373|gb|AKV93707.1| (clade XV lectin receptor kinase [Nicotiana benthamiana])

HSP 1 Score: 82.4 bits (202), Expect = 4.800e-13
Identity = 35/65 (53.85%), Postives = 47/65 (72.31%), Query Frame = 1

		  
Query: 1   MSSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTDSLLPQLPPNRPIVLFPYNS 60
           M + +N +QA+RV+DI LLCTL EN GRP  +E+V FL  +  +P+LPP RP+ LFPYNS
Sbjct: 589 MGAVVNLEQAIRVLDIGLLCTLNENKGRPTIEEVVEFLNMEKPIPELPPGRPVCLFPYNS 648

Query: 61  GPHIC 66
              +C
Sbjct: 649 TTGLC 653

[Close]

BLAST of Spo13281.1 vs. NCBI nr
Match: gi|697175431|ref|XP_009596657.1| (PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like [Nicotiana tomentosiformis])

HSP 1 Score: 82.4 bits (202), Expect = 4.800e-13
Identity = 35/65 (53.85%), Postives = 47/65 (72.31%), Query Frame = 1

		  
Query: 1   MSSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTDSLLPQLPPNRPIVLFPYNS 60
           M + +N +QA+RV+DI LLCTL EN GRP  +E+V FL  +  +P+LPP RP+ LFPYNS
Sbjct: 589 MGAVVNLEQAIRVLDIGLLCTLNENKGRPTMEEVVEFLNMEKPIPELPPGRPVCLFPYNS 648

Query: 61  GPHIC 66
              +C
Sbjct: 649 TTGLC 653

[Close]

BLAST of Spo13281.1 vs. NCBI nr
Match: gi|698476241|ref|XP_009785450.1| (PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like [Nicotiana sylvestris])

HSP 1 Score: 82.4 bits (202), Expect = 4.800e-13
Identity = 35/65 (53.85%), Postives = 47/65 (72.31%), Query Frame = 1

		  
Query: 1   MSSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTDSLLPQLPPNRPIVLFPYNS 60
           M + +N +QA+RV+DI LLCTL EN GRP  +E+V FL  +  +P+LPP RP+ LFPYNS
Sbjct: 589 MGAVVNLEQAIRVLDIGLLCTLNENKGRPTMEEVVEFLNMEKPIPELPPGRPVCLFPYNS 648

Query: 61  GPHIC 66
              +C
Sbjct: 649 TTGLC 653

[Close]

BLAST of Spo13281.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QGQ7_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_181320 PE=4 SV=1)

HSP 1 Score: 134.4 bits (337), Expect = 7.400e-29
Identity = 63/66 (95.45%), Postives = 64/66 (96.97%), Query Frame = 1

		  
Query: 1   MSSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTDSLLPQLPPNRPIVLFPYNS 60
           M SGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTT SLLPQLPPNRPIVLFPYNS
Sbjct: 580 MGSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTVSLLPQLPPNRPIVLFPYNS 639

Query: 61  GPHICG 67
           GPH+CG
Sbjct: 640 GPHLCG 645

[Close]

BLAST of Spo13281.1 vs. UniProtKB/TrEMBL
Match: A0A0J8CWW1_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_3g050710 PE=4 SV=1)

HSP 1 Score: 118.2 bits (295), Expect = 5.500e-24
Identity = 52/66 (78.79%), Postives = 61/66 (92.42%), Query Frame = 1

		  
Query: 1   MSSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTDSLLPQLPPNRPIVLFPYNS 60
           M S ++T+QA+RV+DIALLCTLPENNGRPK +EIVTFLT D +LP+LPPNRPIVLFPYNS
Sbjct: 618 MGSIVDTNQALRVIDIALLCTLPENNGRPKMEEIVTFLTMDCILPELPPNRPIVLFPYNS 677

Query: 61  GPHICG 67
           GPH+CG
Sbjct: 678 GPHLCG 683

[Close]

BLAST of Spo13281.1 vs. UniProtKB/TrEMBL
Match: A0A0K1U1X2_NICBE (Clade XV lectin receptor kinase OS=Nicotiana benthamiana GN=LecRK PE=4 SV=1)

HSP 1 Score: 82.4 bits (202), Expect = 3.300e-13
Identity = 35/65 (53.85%), Postives = 47/65 (72.31%), Query Frame = 1

		  
Query: 1   MSSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTDSLLPQLPPNRPIVLFPYNS 60
           M + +N +QA+RV+DI LLCTL EN GRP  +E+V FL  +  +P+LPP RP+ LFPYNS
Sbjct: 589 MGAVVNLEQAIRVLDIGLLCTLNENKGRPTIEEVVEFLNMEKPIPELPPGRPVCLFPYNS 648

Query: 61  GPHIC 66
              +C
Sbjct: 649 TTGLC 653

[Close]

BLAST of Spo13281.1 vs. UniProtKB/TrEMBL
Match: A0A0D2UZS4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G001800 PE=4 SV=1)

HSP 1 Score: 80.9 bits (198), Expect = 9.700e-13
Identity = 35/65 (53.85%), Postives = 47/65 (72.31%), Query Frame = 1

		  
Query: 1   MSSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTDSLLPQLPPNRPIVLFPYNS 60
           M S +N +QA+R +DI LLCTL E+ GRPK +E+V FL+ D  +P+LP  RP+ LFPYNS
Sbjct: 617 MGSLVNLEQAIRALDIGLLCTLNESKGRPKMEEVVEFLSMDKQIPELPACRPVSLFPYNS 676

Query: 61  GPHIC 66
              +C
Sbjct: 677 ATSLC 681

[Close]

BLAST of Spo13281.1 vs. UniProtKB/TrEMBL
Match: A0A061G1N4_THECC (Concanavalin A-like lectin protein kinase family protein OS=Theobroma cacao GN=TCM_015541 PE=4 SV=1)

HSP 1 Score: 80.5 bits (197), Expect = 1.300e-12
Identity = 34/65 (52.31%), Postives = 48/65 (73.85%), Query Frame = 1

		  
Query: 1   MSSGINTDQAVRVVDIALLCTLPENNGRPKTDEIVTFLTTDSLLPQLPPNRPIVLFPYNS 60
           M S +N +QA+RV+DI LLCTL E+ GRP  +E+V FL+ +  +P+LP +RP+ LFPYNS
Sbjct: 614 MGSLVNLEQAIRVLDIGLLCTLNESKGRPTVEEVVEFLSMERQIPELPASRPVALFPYNS 673

Query: 61  GPHIC 66
              +C
Sbjct: 674 ATGLC 678

The following BLAST results are available for this feature:

BLAST of Spo13281.1 vs. NCBI nr
BLAST of Spo13281.1 vs. UniProtKB/TrEMBL
BLAST of Spo13281.1 vs. ExPASy Swiss-Prot
BLAST of Spo13281.1 vs. TAIR (Arabidopsis)

BLAST of Spo13281.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 5

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description
gi\|902160300\|gb\|KNA06417.1\|	1.1e-28	95.4	hypothetical protein SOVF_1813...	[more]
gi\|731321328\|ref\|XP_010671293.1\|	7.9e-24	78.7	PREDICTED: probable L-type lec...	[more]
gi\|914726373\|gb\|AKV93707.1\|	4.8e-13	53.8	clade XV lectin receptor kinas...	[more]
gi\|697175431\|ref\|XP_009596657.1\|	4.8e-13	53.8	PREDICTED: L-type lectin-domai...	[more]
gi\|698476241\|ref\|XP_009785450.1\|	4.8e-13	53.8	PREDICTED: L-type lectin-domai...	[more]

BLAST of Spo13281.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 5

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description
A0A0K9QGQ7_SPIOL	7.4e-29	95.4	Uncharacterized protein OS=Spi...	[more]
A0A0J8CWW1_BETVU	5.5e-24	78.7	Uncharacterized protein OS=Bet...	[more]
A0A0K1U1X2_NICBE	3.3e-13	53.8	Clade XV lectin receptor kinas...	[more]
A0A0D2UZS4_GOSRA	9.7e-13	53.8	Uncharacterized protein OS=Gos...	[more]
A0A061G1N4_THECC	1.3e-12	52.3	Concanavalin A-like lectin pro...	[more]

BLAST of Spo13281.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo13281.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29

Position :

Zoom :

x 1


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PANTHER	PTHR27007	FAMILY NOT NAMED	coord: 1..92 score: 7.0
None	No IPR available	PANTHER	PTHR27007:SF39	SUBFAMILY NOT NAMED	coord: 1..92 score: 7.0

GO Annotation

GO Assignments

This gene is annotated with the following GO terms.

Category	Term Accession	Term Name
biological_process	GO:0016310	phosphorylation
biological_process	GO:0009698	phenylpropanoid metabolic process
biological_process	GO:0010304	PSII associated light-harvesting complex II catabolic process
biological_process	GO:0035304	regulation of protein dephosphorylation
biological_process	GO:0010027	thylakoid membrane organization
biological_process	GO:0008152	metabolic process
biological_process	GO:0010951	negative regulation of endopeptidase activity
biological_process	GO:0019722	calcium-mediated signaling
biological_process	GO:0007267	cell-cell signaling
biological_process	GO:0042398	cellular modified amino acid biosynthetic process
biological_process	GO:0006598	polyamine catabolic process
biological_process	GO:0019684	photosynthesis, light reaction
biological_process	GO:0048767	root hair elongation
biological_process	GO:0009627	systemic acquired resistance
biological_process	GO:0009069	serine family amino acid metabolic process
biological_process	GO:0007165	signal transduction
biological_process	GO:0006090	pyruvate metabolic process
biological_process	GO:0016049	cell growth
biological_process	GO:0000902	cell morphogenesis
biological_process	GO:0007030	Golgi organization
biological_process	GO:0042793	plastid transcription
biological_process	GO:0006098	pentose-phosphate shunt
biological_process	GO:0007033	vacuole organization
biological_process	GO:0032259	methylation
biological_process	GO:0009767	photosynthetic electron transport chain
biological_process	GO:0080005	photosystem stoichiometry adjustment
biological_process	GO:0006470	protein dephosphorylation
biological_process	GO:0030968	endoplasmic reticulum unfolded protein response
biological_process	GO:0009738	abscisic acid-activated signaling pathway
biological_process	GO:0006468	protein phosphorylation
biological_process	GO:0009987	cellular process
biological_process	GO:0044262	cellular carbohydrate metabolic process
biological_process	GO:0042967	obsolete acyl-carrier-protein biosynthetic process
biological_process	GO:0034660	ncRNA metabolic process
biological_process	GO:0042254	ribosome biogenesis
biological_process	GO:0006412	translation
biological_process	GO:0006474	N-terminal protein amino acid acetylation
biological_process	GO:0016117	carotenoid biosynthetic process
biological_process	GO:0015995	chlorophyll biosynthetic process
biological_process	GO:0009902	chloroplast relocation
biological_process	GO:0019288	isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
biological_process	GO:0009561	megagametogenesis
biological_process	GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic
biological_process	GO:0010228	vegetative to reproductive phase transition of meristem
biological_process	GO:0009695	jasmonic acid biosynthetic process
biological_process	GO:0035196	production of miRNAs involved in gene silencing by miRNA
biological_process	GO:0005975	carbohydrate metabolic process
biological_process	GO:0017001	antibiotic catabolic process
biological_process	GO:0015991	ATP hydrolysis coupled proton transport
biological_process	GO:0048653	anther development
biological_process	GO:0000165	MAPK cascade
biological_process	GO:0006662	glycerol ether metabolic process
biological_process	GO:0007276	gamete generation
biological_process	GO:0000278	mitotic cell cycle
biological_process	GO:0010267	production of ta-siRNAs involved in RNA interference
biological_process	GO:0045900	negative regulation of translational elongation
biological_process	GO:0016567	protein ubiquitination
biological_process	GO:0051302	regulation of cell division
biological_process	GO:0032875	regulation of DNA endoreduplication
biological_process	GO:0051510	regulation of unidimensional cell growth
biological_process	GO:0006511	ubiquitin-dependent protein catabolic process
biological_process	GO:0045454	cell redox homeostasis
biological_process	GO:0006123	mitochondrial electron transport, cytochrome c to oxygen
biological_process	GO:0006661	phosphatidylinositol biosynthetic process
biological_process	GO:0006614	SRP-dependent cotranslational protein targeting to membrane
biological_process	GO:0006750	glutathione biosynthetic process
biological_process	GO:0048573	photoperiodism, flowering
biological_process	GO:0071897	DNA biosynthetic process
biological_process	GO:0008654	phospholipid biosynthetic process
biological_process	GO:0006810	transport
biological_process	GO:0006464	cellular protein modification process
biological_process	GO:0030091	protein repair
biological_process	GO:0006979	response to oxidative stress
biological_process	GO:0042318	penicillin biosynthetic process
biological_process	GO:0006891	intra-Golgi vesicle-mediated transport
biological_process	GO:0032940	secretion by cell
biological_process	GO:0006260	DNA replication
biological_process	GO:0009220	pyrimidine ribonucleotide biosynthetic process
biological_process	GO:0019243	methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione
biological_process	GO:0006650	glycerophospholipid metabolic process
biological_process	GO:0009094	L-phenylalanine biosynthetic process
biological_process	GO:0006432	phenylalanyl-tRNA aminoacylation
biological_process	GO:0000162	tryptophan biosynthetic process
biological_process	GO:0006571	tyrosine biosynthetic process
biological_process	GO:0045017	glycerolipid biosynthetic process
biological_process	GO:0046168	glycerol-3-phosphate catabolic process
biological_process	GO:0015979	photosynthesis
biological_process	GO:0035556	intracellular signal transduction
biological_process	GO:1902600	proton transmembrane transport
biological_process	GO:0009058	biosynthetic process
biological_process	GO:0009813	flavonoid biosynthetic process
biological_process	GO:0032502	developmental process
biological_process	GO:0044206	UMP salvage
biological_process	GO:0006223	uracil salvage
biological_process	GO:0009611	response to wounding
biological_process	GO:0019384	caprolactam catabolic process
biological_process	GO:0006952	defense response
biological_process	GO:0006094	gluconeogenesis
biological_process	GO:0009664	plant-type cell wall organization
biological_process	GO:0046486	glycerolipid metabolic process
biological_process	GO:0006096	glycolytic process
biological_process	GO:0016099	monoterpenoid biosynthetic process
biological_process	GO:0006623	protein targeting to vacuole
biological_process	GO:0007264	small GTPase mediated signal transduction
biological_process	GO:0009744	response to sucrose
biological_process	GO:0032482	Rab protein signal transduction
biological_process	GO:0006570	tyrosine metabolic process
biological_process	GO:0010224	response to UV-B
biological_process	GO:1901576	organic substance biosynthetic process
biological_process	GO:0009790	embryo development
biological_process	GO:0055114	oxidation-reduction process
biological_process	GO:0046520	sphingoid biosynthetic process
biological_process	GO:0016126	sterol biosynthetic process
biological_process	GO:0042761	very long-chain fatty acid biosynthetic process
biological_process	GO:0006888	ER to Golgi vesicle-mediated transport
biological_process	GO:0016226	iron-sulfur cluster assembly
biological_process	GO:0009733	response to auxin
biological_process	GO:0043085	positive regulation of catalytic activity
biological_process	GO:0051176	positive regulation of sulfur metabolic process
biological_process	GO:0044249	cellular biosynthetic process
biological_process	GO:0009755	hormone-mediated signaling pathway
biological_process	GO:0043407	negative regulation of MAP kinase activity
biological_process	GO:0035335	peptidyl-tyrosine dephosphorylation
biological_process	GO:0009737	response to abscisic acid
biological_process	GO:0010075	regulation of meristem growth
biological_process	GO:0080167	response to karrikin
biological_process	GO:0009944	polarity specification of adaxial/abaxial axis
biological_process	GO:0048193	Golgi vesicle transport
biological_process	GO:0009850	auxin metabolic process
biological_process	GO:0030244	cellulose biosynthetic process
biological_process	GO:0009753	response to jasmonic acid
biological_process	GO:0031047	gene silencing by RNA
biological_process	GO:0048438	floral whorl development
biological_process	GO:0048439	flower morphogenesis
biological_process	GO:0048519	negative regulation of biological process
biological_process	GO:0006886	intracellular protein transport
biological_process	GO:0006355	regulation of transcription, DNA-templated
biological_process	GO:0046686	response to cadmium ion
biological_process	GO:0016042	lipid catabolic process
biological_process	GO:0010050	vegetative phase change
biological_process	GO:0009616	virus induced gene silencing
biological_process	GO:0010051	xylem and phloem pattern formation
biological_process	GO:0006633	fatty acid biosynthetic process
biological_process	GO:0009855	determination of bilateral symmetry
biological_process	GO:0010582	floral meristem determinacy
biological_process	GO:0009734	auxin-activated signaling pathway
biological_process	GO:0071816	tail-anchored membrane protein insertion into ER membrane
biological_process	GO:0009620	response to fungus
biological_process	GO:0010200	response to chitin
biological_process	GO:0071554	cell wall organization or biogenesis
biological_process	GO:0009963	positive regulation of flavonoid biosynthetic process
biological_process	GO:0006612	protein targeting to membrane
biological_process	GO:0010363	regulation of plant-type hypersensitive response
biological_process	GO:0006913	nucleocytoplasmic transport
biological_process	GO:0006508	proteolysis
biological_process	GO:0061025	membrane fusion
biological_process	GO:0010014	meristem initiation
biological_process	GO:0009887	animal organ morphogenesis
biological_process	GO:0010158	abaxial cell fate specification
cellular_component	GO:0031461	cullin-RING ubiquitin ligase complex
cellular_component	GO:0005886	plasma membrane
cellular_component	GO:0009507	chloroplast
cellular_component	GO:0005773	vacuole
cellular_component	GO:0032040	small-subunit processome
cellular_component	GO:0016021	integral component of membrane
cellular_component	GO:0019898	extrinsic component of membrane
cellular_component	GO:0009654	photosystem II oxygen evolving complex
cellular_component	GO:0005622	intracellular
cellular_component	GO:0005819	spindle
cellular_component	GO:0016020	membrane
cellular_component	GO:0005576	extracellular region
cellular_component	GO:0005618	cell wall
cellular_component	GO:0033179	proton-transporting V-type ATPase, V0 domain
cellular_component	GO:0009941	chloroplast envelope
cellular_component	GO:0048046	apoplast
cellular_component	GO:0005786	signal recognition particle, endoplasmic reticulum targeting
cellular_component	GO:0005667	transcription factor complex
cellular_component	GO:0009543	chloroplast thylakoid lumen
cellular_component	GO:0005730	nucleolus
cellular_component	GO:0009534	chloroplast thylakoid
cellular_component	GO:0005840	ribosome
cellular_component	GO:0005739	mitochondrion
cellular_component	GO:0009535	chloroplast thylakoid membrane
cellular_component	GO:0009579	thylakoid
cellular_component	GO:0008287	protein serine/threonine phosphatase complex
cellular_component	GO:0009328	phenylalanine-tRNA ligase complex
cellular_component	GO:0009506	plasmodesma
cellular_component	GO:0009331	glycerol-3-phosphate dehydrogenase complex
cellular_component	GO:0005829	cytosol
cellular_component	GO:0045277	respiratory chain complex IV
cellular_component	GO:0009570	chloroplast stroma
cellular_component	GO:0005795	Golgi stack
cellular_component	GO:0005634	nucleus
cellular_component	GO:0005737	cytoplasm
cellular_component	GO:0005768	endosome
cellular_component	GO:0000139	Golgi membrane
cellular_component	GO:0005802	trans-Golgi network
cellular_component	GO:0005774	vacuolar membrane
cellular_component	GO:0042575	DNA polymerase complex
cellular_component	GO:0005789	endoplasmic reticulum membrane
cellular_component	GO:0031248	protein acetyltransferase complex
molecular_function	GO:0008168	methyltransferase activity
molecular_function	GO:0008800	beta-lactamase activity
molecular_function	GO:0019003	GDP binding
molecular_function	GO:0051287	NAD binding
molecular_function	GO:0004416	hydroxyacylglutathione hydrolase activity
molecular_function	GO:0004367	glycerol-3-phosphate dehydrogenase [NAD+] activity
molecular_function	GO:0015035	protein disulfide oxidoreductase activity
molecular_function	GO:0008234	cysteine-type peptidase activity
molecular_function	GO:0004596	peptide alpha-N-acetyltransferase activity
molecular_function	GO:0008233	peptidase activity
molecular_function	GO:0004129	cytochrome-c oxidase activity
molecular_function	GO:0004845	uracil phosphoribosyltransferase activity
molecular_function	GO:0004672	protein kinase activity
molecular_function	GO:0005524	ATP binding
molecular_function	GO:0004722	protein serine/threonine phosphatase activity
molecular_function	GO:0046872	metal ion binding
molecular_function	GO:0003700	DNA-binding transcription factor activity
molecular_function	GO:0003677	DNA binding
molecular_function	GO:0005515	protein binding
molecular_function	GO:0047501	(+)-neomenthol dehydrogenase activity
molecular_function	GO:0047504	(-)-menthol dehydrogenase activity
molecular_function	GO:0008106	alcohol dehydrogenase (NADP+) activity
molecular_function	GO:0008138	protein tyrosine/serine/threonine phosphatase activity
molecular_function	GO:0008270	zinc ion binding
molecular_function	GO:0004725	protein tyrosine phosphatase activity
molecular_function	GO:0008047	enzyme activator activity
molecular_function	GO:0045703	ketoreductase activity
molecular_function	GO:0018454	acetoacetyl-CoA reductase activity
molecular_function	GO:0051082	unfolded protein binding
molecular_function	GO:0031072	heat shock protein binding
molecular_function	GO:0005525	GTP binding
molecular_function	GO:0003924	GTPase activity
molecular_function	GO:0016788	hydrolase activity, acting on ester bonds
molecular_function	GO:0016301	kinase activity
molecular_function	GO:0043565	sequence-specific DNA binding
molecular_function	GO:0004721	phosphoprotein phosphatase activity
molecular_function	GO:0031625	ubiquitin protein ligase binding
molecular_function	GO:0008113	peptide-methionine (S)-S-oxide reductase activity
molecular_function	GO:0004674	protein serine/threonine kinase activity
molecular_function	GO:0015078	proton transmembrane transporter activity
molecular_function	GO:0016787	hydrolase activity
molecular_function	GO:0005047	signal recognition particle binding
molecular_function	GO:0008312	7S RNA binding
molecular_function	GO:0005509	calcium ion binding
molecular_function	GO:0000049	tRNA binding
molecular_function	GO:0004826	phenylalanine-tRNA ligase activity
molecular_function	GO:0017111	nucleoside-triphosphatase activity
molecular_function	GO:0003887	DNA-directed DNA polymerase activity
molecular_function	GO:0016740	transferase activity
molecular_function	GO:0008022	protein C-terminus binding
molecular_function	GO:0004535	poly(A)-specific ribonuclease activity
molecular_function	GO:0004697	protein kinase C activity
molecular_function	GO:0004871	obsolete signal transducer activity
molecular_function	GO:0005179	hormone activity
molecular_function	GO:0005488	binding
molecular_function	GO:0004869	cysteine-type endopeptidase inhibitor activity
molecular_function	GO:0016874	ligase activity
molecular_function	GO:0046982	protein heterodimerization activity
molecular_function	GO:0003735	structural constituent of ribosome
molecular_function	GO:0003723	RNA binding
molecular_function	GO:0016757	transferase activity, transferring glycosyl groups

RNA-Seq Expression

Co-expression


Gene	r value	Expression
Spo11509	0.80	Barchart \| Table
Spo08997	0.79	Barchart \| Table
Spo23857	0.78	Barchart \| Table
Spo25230	0.78	Barchart \| Table
Spo24736	0.78	Barchart \| Table
Spo16960	0.78	Barchart \| Table
Spo20912	0.77	Barchart \| Table
Spo11524	0.76	Barchart \| Table
Spo09752	0.76	Barchart \| Table
Spo16361	0.76	Barchart \| Table
Spo23712	0.76	Barchart \| Table
Spo14942	0.76	Barchart \| Table
Spo03195	0.76	Barchart \| Table
Spo08404	0.75	Barchart \| Table
Spo24590	0.75	Barchart \| Table
Spo04433	0.74	Barchart \| Table
Spo11435	0.74	Barchart \| Table
Spo08114	0.74	Barchart \| Table
Spo00878	0.73	Barchart \| Table
Spo01437	0.73	Barchart \| Table
Spo22999	0.73	Barchart \| Table
Spo09162	0.73	Barchart \| Table
Spo15585	0.73	Barchart \| Table
Spo23286	0.73	Barchart \| Table
Spo05307	0.73	Barchart \| Table
Spo15084	0.73	Barchart \| Table
Spo09267	0.73	Barchart \| Table
Spo08358	0.73	Barchart \| Table
Spo16996	0.73	Barchart \| Table
Spo02696	0.73	Barchart \| Table
Spo22811	0.73	Barchart \| Table
Spo04682	0.73	Barchart \| Table
Spo23382	0.72	Barchart \| Table
Spo06953	0.72	Barchart \| Table
Spo06335	0.72	Barchart \| Table
Spo00283	0.72	Barchart \| Table
Spo01885	0.72	Barchart \| Table
Spo00161	0.72	Barchart \| Table
Spo20106	0.72	Barchart \| Table
Spo18111	0.72	Barchart \| Table
Spo23332	0.72	Barchart \| Table
Spo23384	0.72	Barchart \| Table
Spo00399	0.71	Barchart \| Table
Spo09671	0.71	Barchart \| Table
Spo26986	0.71	Barchart \| Table
Spo11911	0.71	Barchart \| Table
Spo05621	0.71	Barchart \| Table
Spo02648	0.71	Barchart \| Table
Spo11951	0.71	Barchart \| Table
Spo20770	0.71	Barchart \| Table
Spo18578	0.70	Barchart \| Table
Spo16186	0.70	Barchart \| Table
Spo19877	0.70	Barchart \| Table
Spo03149	0.70	Barchart \| Table
Spo04104	0.70	Barchart \| Table
Spo07057	0.70	Barchart \| Table
Spo09387	0.70	Barchart \| Table
Spo22955	0.70	Barchart \| Table
Spo11431	0.70	Barchart \| Table
Spo11668	0.70	Barchart \| Table
Spo11688	0.70	Barchart \| Table
Spo21731	0.70	Barchart \| Table
Spo02848	0.69	Barchart \| Table
Spo25659	0.69	Barchart \| Table
Spo20544	0.69	Barchart \| Table
Spo01187	0.69	Barchart \| Table
Spo01801	0.69	Barchart \| Table
Spo16240	0.69	Barchart \| Table
Spo12376	0.69	Barchart \| Table
Spo15461	0.69	Barchart \| Table
Spo14980	0.69	Barchart \| Table
Spo14403	0.69	Barchart \| Table
Spo15087	0.69	Barchart \| Table
Spo26013	0.69	Barchart \| Table
Spo13209	0.69	Barchart \| Table
Spo13210	0.69	Barchart \| Table
Spo22846	0.69	Barchart \| Table
Spo11417	0.69	Barchart \| Table
Spo13783	0.69	Barchart \| Table
Spo02480	0.69	Barchart \| Table
Spo00677	0.69	Barchart \| Table
Spo06004	0.69	Barchart \| Table
Spo04868	0.69	Barchart \| Table
Spo00205	0.69	Barchart \| Table
Spo25178	0.69	Barchart \| Table
Spo17490	0.69	Barchart \| Table
Spo23401	0.69	Barchart \| Table
Spo20952	0.68	Barchart \| Table
Spo25985	0.68	Barchart \| Table
Spo13905	0.68	Barchart \| Table
Spo00526	0.68	Barchart \| Table
Spo05651	0.68	Barchart \| Table
Spo16804	0.68	Barchart \| Table
Spo05640	0.68	Barchart \| Table
Spo05603	0.68	Barchart \| Table
Spo05402	0.68	Barchart \| Table
Spo00671	0.68	Barchart \| Table
Spo20930	0.68	Barchart \| Table
Spo25330	0.68	Barchart \| Table
Spo09605	0.68	Barchart \| Table
Spo04142	0.68	Barchart \| Table
Spo01054	0.68	Barchart \| Table
Spo25573	0.68	Barchart \| Table
Spo25653	0.68	Barchart \| Table
Spo19217	0.68	Barchart \| Table
Spo10500	0.68	Barchart \| Table
Spo27081	0.68	Barchart \| Table
Spo17726	0.68	Barchart \| Table
Spo17578	0.68	Barchart \| Table
Spo02749	0.68	Barchart \| Table
Spo20187	0.68	Barchart \| Table
Spo14712	0.68	Barchart \| Table
Spo14914	0.68	Barchart \| Table
Spo23580	0.68	Barchart \| Table
Spo02513	0.68	Barchart \| Table
Spo22436	0.68	Barchart \| Table
Spo21635	0.68	Barchart \| Table
Spo17386	0.67	Barchart \| Table
Spo00405	0.67	Barchart \| Table
Spo00575	0.67	Barchart \| Table
Spo00653	0.67	Barchart \| Table
Spo00748	0.67	Barchart \| Table
Spo00872	0.67	Barchart \| Table
Spo01925	0.67	Barchart \| Table
Spo04941	0.67	Barchart \| Table
Spo05338	0.67	Barchart \| Table
Spo06278	0.67	Barchart \| Table
Spo07609	0.67	Barchart \| Table
Spo07892	0.67	Barchart \| Table
Spo09536	0.67	Barchart \| Table
Spo09684	0.67	Barchart \| Table
Spo10019	0.67	Barchart \| Table
Spo10585	0.67	Barchart \| Table
Spo10895	0.67	Barchart \| Table
Spo11073	0.67	Barchart \| Table
Spo12107	0.67	Barchart \| Table
Spo12364	0.67	Barchart \| Table
Spo12952	0.67	Barchart \| Table
Spo13180	0.67	Barchart \| Table
Spo13891	0.67	Barchart \| Table
Spo14630	0.67	Barchart \| Table
Spo15211	0.67	Barchart \| Table
Spo16843	0.67	Barchart \| Table
Spo17169	0.67	Barchart \| Table
Spo17497	0.67	Barchart \| Table
Spo17778	0.67	Barchart \| Table
Spo18694	0.67	Barchart \| Table
Spo21071	0.67	Barchart \| Table
Spo21323	0.67	Barchart \| Table
Spo21446	0.67	Barchart \| Table
Spo21600	0.67	Barchart \| Table
Spo23326	0.67	Barchart \| Table
Spo25717	0.67	Barchart \| Table
Spo25838	0.67	Barchart \| Table
Spo26355	0.67	Barchart \| Table
Spo03896	0.66	Barchart \| Table
Spo17445	0.66	Barchart \| Table
Spo17090	0.66	Barchart \| Table
Spo20415	0.66	Barchart \| Table
Spo17024	0.66	Barchart \| Table
Spo24146	0.66	Barchart \| Table
Spo05923	0.66	Barchart \| Table
Spo24781	0.66	Barchart \| Table
Spo24886	0.66	Barchart \| Table
Spo25008	0.66	Barchart \| Table
Spo25107	0.66	Barchart \| Table
Spo05843	0.66	Barchart \| Table
Spo04179	0.66	Barchart \| Table
Spo17887	0.66	Barchart \| Table
Spo03865	0.66	Barchart \| Table
Spo01261	0.66	Barchart \| Table
Spo25876	0.66	Barchart \| Table
Spo18980	0.66	Barchart \| Table
Spo19035	0.66	Barchart \| Table
Spo19123	0.66	Barchart \| Table
Spo19245	0.66	Barchart \| Table
Spo19288	0.66	Barchart \| Table
Spo19836	0.66	Barchart \| Table
Spo15390	0.66	Barchart \| Table
Spo14096	0.66	Barchart \| Table
Spo13626	0.66	Barchart \| Table
Spo02478	0.66	Barchart \| Table
Spo26168	0.66	Barchart \| Table
Spo27364	0.66	Barchart \| Table
Spo13441	0.66	Barchart \| Table
Spo13161	0.66	Barchart \| Table
Spo22276	0.66	Barchart \| Table
Spo13107	0.66	Barchart \| Table
Spo22583	0.66	Barchart \| Table
Spo11364	0.66	Barchart \| Table
Spo11196	0.66	Barchart \| Table
Spo10512	0.66	Barchart \| Table
Spo26789	0.66	Barchart \| Table
Spo08850	0.66	Barchart \| Table
Spo23549	0.66	Barchart \| Table
Spo08182	0.66	Barchart \| Table
Spo07685	0.66	Barchart \| Table
Spo23772	0.66	Barchart \| Table
Spo06164	0.66	Barchart \| Table
Spo20579	0.65	Barchart \| Table
Spo25171	0.65	Barchart \| Table
Spo15302	0.65	Barchart \| Table
Spo01548	0.65	Barchart \| Table
Spo20937	0.65	Barchart \| Table
Spo10491	0.65	Barchart \| Table
Spo05942	0.65	Barchart \| Table
Spo02106	0.65	Barchart \| Table
Spo10316	0.65	Barchart \| Table
Spo09798	0.65	Barchart \| Table
Spo09769	0.65	Barchart \| Table
Spo04384	0.65	Barchart \| Table
Spo22255	0.65	Barchart \| Table
Spo19850	0.65	Barchart \| Table
Spo18285	0.65	Barchart \| Table
Spo25981	0.65	Barchart \| Table
Spo12954	0.65	Barchart \| Table
Spo03438	0.65	Barchart \| Table