Spo13959 (gene)

Overview
NameSpo13959
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
LocationSpoScf_04534 : 3353 .. 3460 (+)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
TGCACTAGCTGGCTATTCACGGACTGGCTGTACCTACCGTTTCTTTTTTGGGGTCAATATCCGCAATGCAGTTCATCCAACGATAAACAAAACCGAATCCGAATTATA

mRNA sequence

TGCACTAGCTGGCTATTCACGGACTGGCTGTACCTACCGTTTCTTTTTTGGGGTCAATATCCGCAATGCAGTTCATCCAACGATAAACAAAACCGAATCCGAATTATA

Coding sequence (CDS)

TGCACTAGCTGGCTATTCACGGACTGGCTGTACCTACCGTTTCTTTTTTGGGGTCAATATCCGCAATGCAGTTCATCCAACGATAAACAAAACCGAATCCGAATTATA

Protein sequence

CTSWLFTDWLYLPFLFWGQYPQCSSSNDKQNRIRII
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo13959.1Spo13959.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo13959.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo13959.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo13959.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo13959.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006354 DNA-templated transcription, elongation
biological_process GO:0015986 ATP synthesis coupled proton transport
biological_process GO:0042254 ribosome biogenesis
biological_process GO:0009767 photosynthetic electron transport chain
biological_process GO:0051301 cell division
biological_process GO:0015979 photosynthesis
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0008152 metabolic process
biological_process GO:0009769 photosynthesis, light harvesting in photosystem II
biological_process GO:0015991 ATP hydrolysis coupled proton transport
biological_process GO:0006119 oxidative phosphorylation
biological_process GO:0015074 DNA integration
biological_process GO:0018298 protein-chromophore linkage
biological_process GO:0010207 photosystem II assembly
biological_process GO:0009772 photosynthetic electron transport in photosystem II
biological_process GO:0006412 translation
cellular_component GO:0005743 mitochondrial inner membrane
cellular_component GO:0030076 light-harvesting complex
cellular_component GO:0005886 plasma membrane
cellular_component GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)
cellular_component GO:0005840 ribosome
cellular_component GO:0005739 mitochondrion
cellular_component GO:0009507 chloroplast
cellular_component GO:0009535 chloroplast thylakoid membrane
cellular_component GO:0009522 photosystem I
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0009523 photosystem II
cellular_component GO:0010287 plastoglobule
molecular_function GO:0000287 magnesium ion binding
molecular_function GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
molecular_function GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
molecular_function GO:0046961 proton-transporting ATPase activity, rotational mechanism
molecular_function GO:0016168 chlorophyll binding
molecular_function GO:0046872 metal ion binding
molecular_function GO:0045157 electron transporter, transferring electrons within the noncyclic electron transport pathway of photosynthesis activity
molecular_function GO:0009055 electron transfer activity
molecular_function GO:0005506 iron ion binding
molecular_function GO:0016787 hydrolase activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0051539 4 iron, 4 sulfur cluster binding
molecular_function GO:0003735 structural constituent of ribosome
molecular_function GO:0019843 rRNA binding
molecular_function GO:0003676 nucleic acid binding
RNA-Seq Expression