Spo16843 (gene)

Overview
NameSpo16843
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
Locationchr1 : 6551964 .. 6552359 (-)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGCTGCCCTGGATGTCACATTTTTTAGTCGTTTCTGAATGAAATTTGTTTACTTTGGTCATCTGCAGGTGTAGTGTAACTTTTTTCCTCTTGTTCTATGGCCTCTATACTTTTGACAACCTATTCAGTTTCCGAGATGTGCTGCTGAAGTTTTGGGTCAGTGGAAGAATTTCCTTATTTGTTGTAGAATGTGCTTTTACCCAGCAAGGCTTAGATTAGTCAAGAATTTCCTCCTGAATGGCTAATTTTTTAAAATTTAGTGCAAGAATATCAAATATGTACAGCAGGTCTGTAGCTAGGCAAGCAGTGTTTTATGTCAAACTCTGGCTAAATGCAAACTTAAGTAGACTCTTTAATTTGGATGGCAAGCAGTACTATATGTCAAACTCTGGCTAA

mRNA sequence

ATGCTGCCCTGGATGTGTAGTGTAACTTTTTTCCTCTTGTTCTATGGCCTCTATACTTTTGACAACCTATTCAGTTTCCGAGATGTGCTGCTGAAGTTTTGGGTCAGTGGAAGAATTTCCTTATTTGTTGTAGAATGTGCTTTTACCCAGCAAGGCTTAGATTACAGGTCTGTAGCTAGGCAAGCAGTGTTTTATGTCAAACTCTGGCTAAATGCAAACTTAAGTAGACTCTTTAATTTGGATGGCAAGCAGTACTATATGTCAAACTCTGGCTAA

Coding sequence (CDS)

ATGCTGCCCTGGATGTGTAGTGTAACTTTTTTCCTCTTGTTCTATGGCCTCTATACTTTTGACAACCTATTCAGTTTCCGAGATGTGCTGCTGAAGTTTTGGGTCAGTGGAAGAATTTCCTTATTTGTTGTAGAATGTGCTTTTACCCAGCAAGGCTTAGATTACAGGTCTGTAGCTAGGCAAGCAGTGTTTTATGTCAAACTCTGGCTAAATGCAAACTTAAGTAGACTCTTTAATTTGGATGGCAAGCAGTACTATATGTCAAACTCTGGCTAA

Protein sequence

MLPWMCSVTFFLLFYGLYTFDNLFSFRDVLLKFWVSGRISLFVVECAFTQQGLDYRSVARQAVFYVKLWLNANLSRLFNLDGKQYYMSNSG
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo16843.1Spo16843.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo16843.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo16843.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo16843.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo16843.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0033036 macromolecule localization
biological_process GO:0051510 regulation of unidimensional cell growth
biological_process GO:0015991 ATP hydrolysis coupled proton transport
biological_process GO:0009561 megagametogenesis
biological_process GO:0000278 mitotic cell cycle
biological_process GO:0006913 nucleocytoplasmic transport
biological_process GO:0006396 RNA processing
biological_process GO:0001510 RNA methylation
biological_process GO:0035196 production of miRNAs involved in gene silencing by miRNA
biological_process GO:0016567 protein ubiquitination
biological_process GO:0010267 production of ta-siRNAs involved in RNA interference
biological_process GO:0051302 regulation of cell division
biological_process GO:0008152 metabolic process
biological_process GO:0032875 regulation of DNA endoreduplication
biological_process GO:0006511 ubiquitin-dependent protein catabolic process
biological_process GO:0007267 cell-cell signaling
biological_process GO:0007165 signal transduction
biological_process GO:0009069 serine family amino acid metabolic process
biological_process GO:0006468 protein phosphorylation
biological_process GO:0009616 virus induced gene silencing
biological_process GO:0032259 methylation
biological_process GO:0016310 phosphorylation
biological_process GO:0031047 gene silencing by RNA
biological_process GO:0071702 organic substance transport
biological_process GO:0007276 gamete generation
cellular_component GO:0031461 cullin-RING ubiquitin ligase complex
cellular_component GO:0005634 nucleus
cellular_component GO:0005819 spindle
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0009941 chloroplast envelope
cellular_component GO:0033179 proton-transporting V-type ATPase, V0 domain
cellular_component GO:0005886 plasma membrane
molecular_function GO:0015078 proton transmembrane transporter activity
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0019905 syntaxin binding
molecular_function GO:0031625 ubiquitin protein ligase binding
molecular_function GO:0016874 ligase activity
molecular_function GO:0005488 binding
molecular_function GO:0016301 kinase activity
molecular_function GO:0008168 methyltransferase activity
molecular_function GO:0005515 protein binding
molecular_function GO:0005524 ATP binding
molecular_function GO:0016787 hydrolase activity
molecular_function GO:0004697 protein kinase C activity
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
molecular_function GO:0008173 RNA methyltransferase activity
molecular_function GO:0030246 carbohydrate binding
molecular_function GO:0008171 O-methyltransferase activity
RNA-Seq Expression