Spo17945 (gene)

Overview
NameSpo17945
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
Locationchr4 : 38114737 .. 38114994 (+)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGAATTGGTGTCCATATATGTTAAAATGTAAGTGTTTTTTTTTTTTTTTTTTGACAACAAAAAGAAAAAGAAGAAAAGAGCAGAAGAAAAAAAAAGGGAAATTAAGATTTTCATTCTCTGTTATTCCCTCTTTTCTCCTTTTTCGTTCCGATATCTGTAATTTCCTTTTAACATTTTCTTGGTTAGGTGAAGGATTCTGTAAATGCCCGTTGCCGCTATTAGAACTTGTATCTATACAACTCCCATCCATATTATAG

mRNA sequence

ATGAATTGGTGTCCATATATGTTAAAATGTAAGTGTTTTTTTTTTTTTTTTTTGACAACAAAAAGAAAAAGAAGAAAAGAGCAGAAGAAAAAAAAAGGGAAATTAAGATTTTCATTCTCTGTTATTCCCTCTTTTCTCCTTTTTCGTTCCGATATCTGTAATTTCCTTTTAACATTTTCTTGGTTAGGTGAAGGATTCTGTAAATGCCCGTTGCCGCTATTAGAACTTGTATCTATACAACTCCCATCCATATTATAG

Coding sequence (CDS)

ATGAATTGGTGTCCATATATGTTAAAATGTAAGTGTTTTTTTTTTTTTTTTTTGACAACAAAAAGAAAAAGAAGAAAAGAGCAGAAGAAAAAAAAAGGGAAATTAAGATTTTCATTCTCTGTTATTCCCTCTTTTCTCCTTTTTCGTTCCGATATCTGTAATTTCCTTTTAACATTTTCTTGGTTAGGTGAAGGATTCTGTAAATGCCCGTTGCCGCTATTAGAACTTGTATCTATACAACTCCCATCCATATTATAG

Protein sequence

MNWCPYMLKCKCFFFFFLTTKRKRRKEQKKKKGKLRFSFSVIPSFLLFRSDICNFLLTFSWLGEGFCKCPLPLLELVSIQLPSIL
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo17945.1Spo17945.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo17945.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo17945.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo17945.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo17945.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
biological_process GO:0044260 cellular macromolecule metabolic process
biological_process GO:0016049 cell growth
biological_process GO:0000902 cell morphogenesis
biological_process GO:0016197 endosomal transport
biological_process GO:0006891 intra-Golgi vesicle-mediated transport
biological_process GO:0006869 lipid transport
biological_process GO:0010351 lithium ion transport
biological_process GO:0016558 protein import into peroxisome matrix
biological_process GO:0006470 protein dephosphorylation
biological_process GO:0006810 transport
biological_process GO:0016567 protein ubiquitination
biological_process GO:0005975 carbohydrate metabolic process
biological_process GO:0044262 cellular carbohydrate metabolic process
biological_process GO:0009987 cellular process
biological_process GO:0010118 stomatal movement
biological_process GO:0030003 cellular cation homeostasis
biological_process GO:0070838 divalent metal ion transport
biological_process GO:0046777 protein autophosphorylation
biological_process GO:0007165 signal transduction
biological_process GO:0046486 glycerolipid metabolic process
biological_process GO:0006769 nicotinamide metabolic process
biological_process GO:0046497 nicotinate nucleotide metabolic process
biological_process GO:0009395 phospholipid catabolic process
biological_process GO:0016310 phosphorylation
biological_process GO:0007205 protein kinase C-activating G-protein coupled receptor signaling pathway
biological_process GO:0048193 Golgi vesicle transport
biological_process GO:0043547 positive regulation of GTPase activity
biological_process GO:0043087 regulation of GTPase activity
biological_process GO:0007020 microtubule nucleation
biological_process GO:0006623 protein targeting to vacuole
biological_process GO:0009069 serine family amino acid metabolic process
biological_process GO:0019722 calcium-mediated signaling
biological_process GO:0018342 protein prenylation
biological_process GO:0018345 protein palmitoylation
biological_process GO:0048527 lateral root development
biological_process GO:0007186 G-protein coupled receptor signaling pathway
biological_process GO:0006308 DNA catabolic process
biological_process GO:0009738 abscisic acid-activated signaling pathway
biological_process GO:0010540 basipetal auxin transport
biological_process GO:0009966 regulation of signal transduction
biological_process GO:0043666 regulation of phosphoprotein phosphatase activity
biological_process GO:0050790 regulation of catalytic activity
biological_process GO:0016036 cellular response to phosphate starvation
biological_process GO:0042631 cellular response to water deprivation
biological_process GO:0000911 cytokinesis by cell plate formation
biological_process GO:0019375 galactolipid biosynthetic process
biological_process GO:0010107 potassium ion import
biological_process GO:0009723 response to ethylene
biological_process GO:0007584 response to nutrient
biological_process GO:0016311 dephosphorylation
biological_process GO:0009264 deoxyribonucleotide catabolic process
biological_process GO:0009845 seed germination
cellular_component GO:0005634 nucleus
cellular_component GO:0045254 pyruvate dehydrogenase complex
cellular_component GO:0005739 mitochondrion
cellular_component GO:0005794 Golgi apparatus
cellular_component GO:0009507 chloroplast
cellular_component GO:0005773 vacuole
cellular_component GO:0005834 heterotrimeric G-protein complex
cellular_component GO:0005795 Golgi stack
cellular_component GO:0005829 cytosol
cellular_component GO:0031902 late endosome membrane
cellular_component GO:0005802 trans-Golgi network
cellular_component GO:0005886 plasma membrane
cellular_component GO:0009536 plastid
cellular_component GO:0009543 chloroplast thylakoid lumen
cellular_component GO:0009535 chloroplast thylakoid membrane
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005096 GTPase activator activity
molecular_function GO:0004143 diacylglycerol kinase activity
molecular_function GO:0004672 protein kinase activity
molecular_function GO:0005267 potassium channel activity
molecular_function GO:0004674 protein serine/threonine kinase activity
molecular_function GO:0005515 protein binding
molecular_function GO:0003951 NAD+ kinase activity
molecular_function GO:0005543 phospholipid binding
molecular_function GO:0004871 obsolete signal transducer activity
molecular_function GO:0004864 protein phosphatase inhibitor activity
molecular_function GO:0008253 5'-nucleotidase activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0004842 ubiquitin-protein transferase activity
molecular_function GO:0004740 pyruvate dehydrogenase (acetyl-transferring) kinase activity
molecular_function GO:0042803 protein homodimerization activity
molecular_function GO:0009927 histidine phosphotransfer kinase activity
molecular_function GO:0005484 SNAP receptor activity
molecular_function GO:0005483 soluble NSF attachment protein activity
molecular_function GO:0046872 metal ion binding
molecular_function GO:0004721 phosphoprotein phosphatase activity
molecular_function GO:0016881 acid-amino acid ligase activity
molecular_function GO:0008270 zinc ion binding
RNA-Seq Expression
   



Co-expression
Gener valueExpression
Spo146300.75Barchart | Table
Spo256330.72Barchart | Table
Spo094990.72Barchart | Table
Spo048630.71Barchart | Table
Spo098420.71Barchart | Table
Spo179790.71Barchart | Table
Spo199420.71Barchart | Table
Spo216000.71Barchart | Table
Spo170240.70Barchart | Table
Spo218330.70Barchart | Table
Spo149800.70Barchart | Table
Spo189430.70Barchart | Table
Spo264240.70Barchart | Table
Spo176100.69Barchart | Table
Spo129620.69Barchart | Table
Spo229550.69Barchart | Table
Spo137830.69Barchart | Table
Spo104440.69Barchart | Table
Spo005260.69Barchart | Table
Spo231040.68Barchart | Table
Spo053070.68Barchart | Table
Spo266100.68Barchart | Table
Spo255730.68Barchart | Table
Spo273520.68Barchart | Table
Spo173330.68Barchart | Table
Spo126590.68Barchart | Table
Spo220520.68Barchart | Table
Spo146670.68Barchart | Table
Spo191230.68Barchart | Table
Spo256140.67Barchart | Table
Spo019250.67Barchart | Table
Spo114820.67Barchart | Table
Spo145370.67Barchart | Table
Spo209120.67Barchart | Table
Spo243350.67Barchart | Table
Spo282650.66Barchart | Table
Spo007480.66Barchart | Table
Spo142400.66Barchart | Table
Spo086030.66Barchart | Table
Spo192170.66Barchart | Table
Spo139050.66Barchart | Table
Spo065690.66Barchart | Table
Spo266400.66Barchart | Table
Spo199360.66Barchart | Table
Spo177260.66Barchart | Table
Spo123760.66Barchart | Table
Spo149420.66Barchart | Table
Spo185780.65Barchart | Table
Spo169600.65Barchart | Table
Spo140840.65Barchart | Table
Spo226590.65Barchart | Table
Spo123640.65Barchart | Table
Spo114170.65Barchart | Table
Spo088500.65Barchart | Table
Spo256530.65Barchart | Table
Spo085210.65Barchart | Table
Spo181300.65Barchart | Table