Spo19383 (gene)

Overview
NameSpo19383
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
LocationSpoScf_00896 : 31266 .. 31487 (-)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGTACCATACATGTTCAACATATACATCTTACCCTTAGCTAGCTTACGTAGACCCCACCATTTAACCCCCTTTCCCTTCCACCACCACGCCAACTCCACATACATACTCCTCTCCAAGACTCTCTTTTCTTCACATTTTCTTCCTCTAGCTATCTTGTCTTTCAATCCCCACTTTTCTTCAACTTCTTCTGATCTTTACCCTTTTTCTCTTCTAAATTAA

mRNA sequence

ATGGTACCATACATGTTCAACATATACATCTTACCCTTAGCTAGCTTACGTAGACCCCACCATTTAACCCCCTTTCCCTTCCACCACCACGCCAACTCCACATACATACTCCTCTCCAAGACTCTCTTTTCTTCACATTTTCTTCCTCTAGCTATCTTGTCTTTCAATCCCCACTTTTCTTCAACTTCTTCTGATCTTTACCCTTTTTCTCTTCTAAATTAA

Coding sequence (CDS)

ATGGTACCATACATGTTCAACATATACATCTTACCCTTAGCTAGCTTACGTAGACCCCACCATTTAACCCCCTTTCCCTTCCACCACCACGCCAACTCCACATACATACTCCTCTCCAAGACTCTCTTTTCTTCACATTTTCTTCCTCTAGCTATCTTGTCTTTCAATCCCCACTTTTCTTCAACTTCTTCTGATCTTTACCCTTTTTCTCTTCTAAATTAA

Protein sequence

MVPYMFNIYILPLASLRRPHHLTPFPFHHHANSTYILLSKTLFSSHFLPLAILSFNPHFSSTSSDLYPFSLLN
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo19383.1Spo19383.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo19383.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo19383.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo19383.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo19383.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0009658 chloroplast organization
biological_process GO:0006888 ER to Golgi vesicle-mediated transport
biological_process GO:0035265 organ growth
biological_process GO:0006457 protein folding
biological_process GO:0042908 xenobiotic transport
biological_process GO:0007165 signal transduction
biological_process GO:0009651 response to salt stress
biological_process GO:0000226 microtubule cytoskeleton organization
biological_process GO:0008152 metabolic process
biological_process GO:0006855 drug transmembrane transport
biological_process GO:0048767 root hair elongation
biological_process GO:0000911 cytokinesis by cell plate formation
biological_process GO:0030007 cellular potassium ion homeostasis
biological_process GO:0043090 amino acid import
biological_process GO:0032984 protein-containing complex disassembly
biological_process GO:0006470 protein dephosphorylation
biological_process GO:0006768 biotin metabolic process
biological_process GO:0006464 cellular protein modification process
cellular_component GO:0009706 chloroplast inner membrane
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0005774 vacuolar membrane
cellular_component GO:0000325 plant-type vacuole
cellular_component GO:0009535 chloroplast thylakoid membrane
cellular_component GO:0009941 chloroplast envelope
molecular_function GO:0008281 sulfonylurea receptor activity
molecular_function GO:0008559 xenobiotic transmembrane transporting ATPase activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0043621 protein self-association
molecular_function GO:0005515 protein binding
molecular_function GO:0003756 protein disulfide isomerase activity
molecular_function GO:0004721 phosphoprotein phosphatase activity
molecular_function GO:0046872 metal ion binding
molecular_function GO:0004077 biotin-[acetyl-CoA-carboxylase] ligase activity
RNA-Seq Expression