Spo20686 (gene) | SpinachBase

Overview


Name	Spo20686
Type	gene
Organism	Spinacia oleracea (Spinach)
Description	Unknown protein
Location	SpoScf_01308 : 181240 .. 181979 (-)

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGAACAAGATGAAGTTTGCAAGTTTTGGGCAGTGCTACCTCCATGTGCAGTACCTGCTGGCTTCCCTGATGCTAATCTATGGTTTTACAACGCAGTTTTCATCAAACCCGAATACGTCGCAAGTTGGGAATGTTGCTCTCGCAGTTGGATTTTTACTCATTATGCTCATCAATCTATATGATTTGATATGTAGTATAATAGGATTTGGTAACCAGTCTTCAAAAGTAGAGCTTTTGATGGATCTTGAGTCTGCAATTCCAACTATTCGTTTTGTTGGGGCACTACTCTCACTTGGATCCATGATCACAAATCAGGTCAGTTTTAGCAATTCATTTTATTTTTGGAATACAAATAAATCATGTATTAAAATGTTAATTTTGATTTACAACAATACATCACCAAACGATACGATTTATAAGTTTGAACACATTATGATTCTATGAAAAACCATCAAAAACAAGTTGTGGGACATGATTTAATTATATTGTTATGCCTTTTTTCTTCTTCTTTGATATGTTATTTTTTAATATTTTTGTTGTGAAATTACTAGTATATTGAATTTAACTTTTTATACATATAGTTTTCGTGGCATCAAAACTGAGGTTTTGGTATCATATTCATGTAGGGACAAGCTTCTATGGTGTGGTTTGGAGTGGTAGGAAGCTTCTTGATCTTCATAGGAGGATTGTTGAACACCTTTAGGGTATTGAAGATGAACCAGATGCAACGACAACAATAG

mRNA sequence

ATGAACAAGATGAAGTTTGCAAGTTTTGGGCAGTGCTACCTCCATGTGCAGTACCTGCTGGCTTCCCTGATGCTAATCTATGGTTTTACAACGCAGTTTTCATCAAACCCGAATACGTCGCAAGTTGGGAATGTTGCTCTCGCAGTTGGATTTTTACTCATTATGCTCATCAATCTATATGATTTGATATGTAGTATAATAGGATTTGGTAACCAGTCTTCAAAAGTAGAGCTTTTGATGGATCTTGAGTCTGCAATTCCAACTATTCGTTTTGTTGGGGCACTACTCTCACTTGGATCCATGATCACAAATCAGGGACAAGCTTCTATGGTGTGGTTTGGAGTGGTAGGAAGCTTCTTGATCTTCATAGGAGGATTGTTGAACACCTTTAGGGTATTGAAGATGAACCAGATGCAACGACAACAATAG

Coding sequence (CDS)

ATGAACAAGATGAAGTTTGCAAGTTTTGGGCAGTGCTACCTCCATGTGCAGTACCTGCTGGCTTCCCTGATGCTAATCTATGGTTTTACAACGCAGTTTTCATCAAACCCGAATACGTCGCAAGTTGGGAATGTTGCTCTCGCAGTTGGATTTTTACTCATTATGCTCATCAATCTATATGATTTGATATGTAGTATAATAGGATTTGGTAACCAGTCTTCAAAAGTAGAGCTTTTGATGGATCTTGAGTCTGCAATTCCAACTATTCGTTTTGTTGGGGCACTACTCTCACTTGGATCCATGATCACAAATCAGGGACAAGCTTCTATGGTGTGGTTTGGAGTGGTAGGAAGCTTCTTGATCTTCATAGGAGGATTGTTGAACACCTTTAGGGTATTGAAGATGAACCAGATGCAACGACAACAATAG

Protein sequence

MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLYDLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQGQASMVWFGVVGSFLIFIGGLLNTFRVLKMNQMQRQQ

Relationships

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Type
Spo20686.1	Spo20686.1	mRNA

Homology

[Close]

BLAST of Spo20686.1 vs. NCBI nr
Match: gi|902162381|gb|KNA06679.1| (hypothetical protein SOVF_178780 isoform B [Spinacia oleracea])

HSP 1 Score: 273.9 bits (699), Expect = 1.600e-70
Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 1

		  
Query: 1   MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY 60
           MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY
Sbjct: 1   MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY 60

Query: 61  DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQGQASMVWFGVVGSFL 120
           DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQGQASMVWFGVVGSFL
Sbjct: 61  DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQGQASMVWFGVVGSFL 120

Query: 121 IFIGGLLNTFRVLKMNQMQRQQ 143
           IFIGGLLNTFRVLKMNQMQRQQ
Sbjct: 121 IFIGGLLNTFRVLKMNQMQRQQ 142

[Close]

BLAST of Spo20686.1 vs. NCBI nr
Match: gi|902162380|gb|KNA06678.1| (hypothetical protein SOVF_178780 isoform A [Spinacia oleracea])

HSP 1 Score: 203.0 bits (515), Expect = 3.500e-49
Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 1

		  
Query: 1   MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY 60
           MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY
Sbjct: 1   MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY 60

Query: 61  DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQ 106
           DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQ
Sbjct: 61  DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQ 105

[Close]

BLAST of Spo20686.1 vs. NCBI nr
Match: gi|743927538|ref|XP_011007946.1| (PREDICTED: uncharacterized protein LOC105113464 [Populus euphratica])

HSP 1 Score: 70.9 bits (172), Expect = 2.100e-9
Identity = 50/147 (34.01%), Postives = 80/147 (54.42%), Query Frame = 1

		  
Query: 2   NKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLYD 61
           N+ ++ + G C      + A+++L+ GF  + S  P +   G V L +G LLIM++NL+D
Sbjct: 20  NRGEYMNAGLC------VFAAIVLVGGFVAELSKEPKS---GLVLLLIGLLLIMVVNLHD 79

Query: 62  LICSIIG----FGNQSSKVELLMDLESAIPTIRFVGALLS-LGSM-----ITNQGQASMV 121
           L+  + G    F       +L + +E A+P ++  GALLS LG +     +      + V
Sbjct: 80  LVAHLAGIDYRFPLMGFDTQLAL-VEFAVPVVQASGALLSFLGILFLFIQVLEIAGKTWV 139

Query: 122 WFGVVGSFLIFIGGLLNTFRVLKMNQM 139
           W G+ GS +IFIGGL N  +V KM Q+
Sbjct: 140 WTGICGSLMIFIGGLANAVKVFKMQQI 156

[Close]

BLAST of Spo20686.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QHH1_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_178780 PE=4 SV=1)

HSP 1 Score: 273.9 bits (699), Expect = 1.100e-70
Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 1

		  
Query: 1   MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY 60
           MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY
Sbjct: 1   MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY 60

Query: 61  DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQGQASMVWFGVVGSFL 120
           DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQGQASMVWFGVVGSFL
Sbjct: 61  DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQGQASMVWFGVVGSFL 120

Query: 121 IFIGGLLNTFRVLKMNQMQRQQ 143
           IFIGGLLNTFRVLKMNQMQRQQ
Sbjct: 121 IFIGGLLNTFRVLKMNQMQRQQ 142

[Close]

BLAST of Spo20686.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QJ17_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_178780 PE=4 SV=1)

HSP 1 Score: 203.0 bits (515), Expect = 2.400e-49
Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 1

		  
Query: 1   MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY 60
           MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY
Sbjct: 1   MNKMKFASFGQCYLHVQYLLASLMLIYGFTTQFSSNPNTSQVGNVALAVGFLLIMLINLY 60

Query: 61  DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQ 106
           DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQ
Sbjct: 61  DLICSIIGFGNQSSKVELLMDLESAIPTIRFVGALLSLGSMITNQ 105

The following BLAST results are available for this feature:

BLAST of Spo20686.1 vs. NCBI nr
BLAST of Spo20686.1 vs. UniProtKB/TrEMBL
BLAST of Spo20686.1 vs. ExPASy Swiss-Prot
BLAST of Spo20686.1 vs. TAIR (Arabidopsis)

BLAST of Spo20686.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 3

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description
gi\|902162381\|gb\|KNA06679.1\|	1.6e-70	100.	hypothetical protein SOVF_1787...	[more]
gi\|902162380\|gb\|KNA06678.1\|	3.5e-49	100.	hypothetical protein SOVF_1787...	[more]
gi\|743927538\|ref\|XP_011007946.1\|	2.1e-9	34.0	PREDICTED: uncharacterized pro...	[more]

BLAST of Spo20686.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 2

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description
A0A0K9QHH1_SPIOL	1.1e-70	100.	Uncharacterized protein OS=Spi...	[more]
A0A0K9QJ17_SPIOL	2.4e-49	100.	Uncharacterized protein OS=Spi...	[more]

BLAST of Spo20686.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo20686.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

GO Annotation

GO Assignments

This gene is annotated with the following GO terms.

Category	Term Accession	Term Name
biological_process	GO:0055114	oxidation-reduction process
biological_process	GO:0000394	RNA splicing, via endonucleolytic cleavage and ligation
biological_process	GO:0009640	photomorphogenesis
biological_process	GO:0045893	positive regulation of transcription, DNA-templated
biological_process	GO:0043687	post-translational protein modification
biological_process	GO:0000338	protein deneddylation
biological_process	GO:0016579	protein deubiquitination
biological_process	GO:0016567	protein ubiquitination
biological_process	GO:0032447	protein urmylation
biological_process	GO:0080157	regulation of plant-type cell wall organization or biogenesis
biological_process	GO:0000302	response to reactive oxygen species
biological_process	GO:0009410	response to xenobiotic stimulus
biological_process	GO:0006396	RNA processing
biological_process	GO:0034227	tRNA thio-modification
biological_process	GO:0002098	tRNA wobble uridine modification
biological_process	GO:0006366	transcription by RNA polymerase II
biological_process	GO:0016571	histone methylation
biological_process	GO:0031990	mRNA export from nucleus in response to heat stress
biological_process	GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
biological_process	GO:0045948	positive regulation of translational initiation
biological_process	GO:0034402	recruitment of 3'-end processing factors to RNA polymerase II holoenzyme complex
biological_process	GO:0006367	transcription initiation from RNA polymerase II promoter
biological_process	GO:0030001	metal ion transport
biological_process	GO:0015991	ATP hydrolysis coupled proton transport
biological_process	GO:0006119	oxidative phosphorylation
biological_process	GO:0006810	transport
biological_process	GO:0010162	seed dormancy process
biological_process	GO:0071897	DNA biosynthetic process
biological_process	GO:0006260	DNA replication
biological_process	GO:0090305	nucleic acid phosphodiester bond hydrolysis
biological_process	GO:0006302	double-strand break repair
biological_process	GO:0000278	mitotic cell cycle
biological_process	GO:0009611	response to wounding
biological_process	GO:0006891	intra-Golgi vesicle-mediated transport
biological_process	GO:0009432	SOS response
biological_process	GO:0016049	cell growth
biological_process	GO:0000902	cell morphogenesis
biological_process	GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic
biological_process	GO:0010228	vegetative to reproductive phase transition of meristem
biological_process	GO:0006446	regulation of translational initiation
biological_process	GO:0006979	response to oxidative stress
biological_process	GO:0030968	endoplasmic reticulum unfolded protein response
biological_process	GO:0031348	negative regulation of defense response
biological_process	GO:0009697	salicylic acid biosynthetic process
biological_process	GO:0009863	salicylic acid mediated signaling pathway
biological_process	GO:0009691	cytokinin biosynthetic process
biological_process	GO:0006281	DNA repair
biological_process	GO:0007131	reciprocal meiotic recombination
biological_process	GO:0006886	intracellular protein transport
biological_process	GO:0009414	response to water deprivation
biological_process	GO:0016192	vesicle-mediated transport
biological_process	GO:0006887	exocytosis
biological_process	GO:0010264	myo-inositol hexakisphosphate biosynthetic process
biological_process	GO:0006098	pentose-phosphate shunt
biological_process	GO:0010027	thylakoid membrane organization
biological_process	GO:0009738	abscisic acid-activated signaling pathway
biological_process	GO:0042538	hyperosmotic salinity response
biological_process	GO:0009853	photorespiration
biological_process	GO:0009695	jasmonic acid biosynthetic process
biological_process	GO:0009867	jasmonic acid mediated signaling pathway
biological_process	GO:0006612	protein targeting to membrane
biological_process	GO:0010363	regulation of plant-type hypersensitive response
biological_process	GO:0009733	response to auxin
biological_process	GO:0009723	response to ethylene
biological_process	GO:0010332	response to gamma radiation
biological_process	GO:0008152	metabolic process
biological_process	GO:0006144	purine nucleobase metabolic process
biological_process	GO:0016132	brassinosteroid biosynthetic process
biological_process	GO:0046497	nicotinate nucleotide metabolic process
biological_process	GO:0009395	phospholipid catabolic process
biological_process	GO:0016310	phosphorylation
biological_process	GO:0007205	protein kinase C-activating G-protein coupled receptor signaling pathway
biological_process	GO:0000165	MAPK cascade
biological_process	GO:0045892	negative regulation of transcription, DNA-templated
biological_process	GO:0009693	ethylene biosynthetic process
biological_process	GO:0006687	glycosphingolipid metabolic process
biological_process	GO:0042967	obsolete acyl-carrier-protein biosynthetic process
biological_process	GO:0009555	pollen development
biological_process	GO:0043067	regulation of programmed cell death
biological_process	GO:0046512	sphingosine biosynthetic process
biological_process	GO:0006084	acetyl-CoA metabolic process
biological_process	GO:0016126	sterol biosynthetic process
biological_process	GO:0006465	signal peptide processing
biological_process	GO:0006464	cellular protein modification process
biological_process	GO:0006633	fatty acid biosynthetic process
biological_process	GO:0098734	macromolecule depalmitoylation
biological_process	GO:0006123	mitochondrial electron transport, cytochrome c to oxygen
biological_process	GO:0052542	defense response by callose deposition
biological_process	GO:0043069	negative regulation of programmed cell death
biological_process	GO:0016117	carotenoid biosynthetic process
biological_process	GO:0009658	chloroplast organization
biological_process	GO:0009266	response to temperature stimulus
biological_process	GO:0009873	ethylene-activated signaling pathway
biological_process	GO:0016311	dephosphorylation
biological_process	GO:0019497	hexachlorocyclohexane metabolic process
biological_process	GO:0006771	riboflavin metabolic process
biological_process	GO:0009734	auxin-activated signaling pathway
biological_process	GO:0006769	nicotinamide metabolic process
biological_process	GO:0006614	SRP-dependent cotranslational protein targeting to membrane
biological_process	GO:0006913	nucleocytoplasmic transport
biological_process	GO:0006094	gluconeogenesis
biological_process	GO:0032940	secretion by cell
biological_process	GO:0007264	small GTPase mediated signal transduction
biological_process	GO:0006325	chromatin organization
biological_process	GO:0009909	regulation of flower development
biological_process	GO:0009637	response to blue light
biological_process	GO:0007165	signal transduction
biological_process	GO:0006457	protein folding
biological_process	GO:0005982	starch metabolic process
biological_process	GO:0005985	sucrose metabolic process
biological_process	GO:0019260	1,2-dichloroethane catabolic process
biological_process	GO:0006525	arginine metabolic process
biological_process	GO:0019482	beta-alanine metabolic process
biological_process	GO:0006699	bile acid biosynthetic process
biological_process	GO:0006631	fatty acid metabolic process
biological_process	GO:0046486	glycerolipid metabolic process
biological_process	GO:0045900	negative regulation of translational elongation
biological_process	GO:0006096	glycolytic process
biological_process	GO:0006547	histidine metabolic process
biological_process	GO:0006550	isoleucine catabolic process
biological_process	GO:0019852	L-ascorbic acid metabolic process
biological_process	GO:0006552	leucine catabolic process
biological_process	GO:0046251	limonene catabolic process
biological_process	GO:0006554	lysine catabolic process
biological_process	GO:0006560	proline metabolic process
biological_process	GO:0042572	retinol metabolic process
biological_process	GO:0006568	tryptophan metabolic process
biological_process	GO:0006574	valine catabolic process
biological_process	GO:0044262	cellular carbohydrate metabolic process
biological_process	GO:0044260	cellular macromolecule metabolic process
biological_process	GO:0009987	cellular process
biological_process	GO:0006351	transcription, DNA-templated
biological_process	GO:0007229	integrin-mediated signaling pathway
biological_process	GO:0010951	negative regulation of endopeptidase activity
biological_process	GO:0044375	regulation of peroxisome size
biological_process	GO:0006227	dUDP biosynthetic process
biological_process	GO:0046939	nucleotide phosphorylation
biological_process	GO:0006206	pyrimidine nucleobase metabolic process
biological_process	GO:0042255	ribosome assembly
biological_process	GO:0005975	carbohydrate metabolic process
biological_process	GO:0006606	protein import into nucleus
biological_process	GO:0016559	peroxisome fission
biological_process	GO:1902600	proton transmembrane transport
biological_process	GO:0031347	regulation of defense response
biological_process	GO:0009627	systemic acquired resistance
biological_process	GO:0006233	dTDP biosynthetic process
biological_process	GO:0009409	response to cold
biological_process	GO:0009560	embryo sac egg cell differentiation
biological_process	GO:0042545	cell wall modification
biological_process	GO:0009664	plant-type cell wall organization
biological_process	GO:0006508	proteolysis
biological_process	GO:0080167	response to karrikin
biological_process	GO:0050790	regulation of catalytic activity
biological_process	GO:0043666	regulation of phosphoprotein phosphatase activity
biological_process	GO:0009966	regulation of signal transduction
biological_process	GO:0006235	dTTP biosynthetic process
biological_process	GO:0006605	protein targeting
biological_process	GO:0009767	photosynthetic electron transport chain
biological_process	GO:0048193	Golgi vesicle transport
biological_process	GO:0055085	transmembrane transport
biological_process	GO:0007033	vacuole organization
biological_process	GO:0006623	protein targeting to vacuole
biological_process	GO:0009816	defense response to bacterium, incompatible interaction
biological_process	GO:0018108	peptidyl-tyrosine phosphorylation
biological_process	GO:0046777	protein autophosphorylation
biological_process	GO:0009069	serine family amino acid metabolic process
biological_process	GO:0007030	Golgi organization
biological_process	GO:0006007	glucose catabolic process
biological_process	GO:0070676	intralumenal vesicle formation
biological_process	GO:0006334	nucleosome assembly
biological_process	GO:0061025	membrane fusion
biological_process	GO:0010200	response to chitin
biological_process	GO:0009644	response to high light intensity
biological_process	GO:0042542	response to hydrogen peroxide
biological_process	GO:0007034	vacuolar transport
biological_process	GO:0032259	methylation
biological_process	GO:0006816	calcium ion transport
biological_process	GO:0006412	translation
biological_process	GO:0042254	ribosome biogenesis
biological_process	GO:0006897	endocytosis
biological_process	GO:0050896	response to stimulus
biological_process	GO:0009651	response to salt stress
biological_process	GO:0080005	photosystem stoichiometry adjustment
biological_process	GO:0030488	tRNA methylation
biological_process	GO:0006012	galactose metabolic process
biological_process	GO:0046835	carbohydrate phosphorylation
biological_process	GO:0044070	regulation of anion transport
biological_process	GO:0001510	RNA methylation
biological_process	GO:0006355	regulation of transcription, DNA-templated
biological_process	GO:0006468	protein phosphorylation
biological_process	GO:0009735	response to cytokinin
biological_process	GO:0006354	DNA-templated transcription, elongation
biological_process	GO:0051788	response to misfolded protein
biological_process	GO:0006511	ubiquitin-dependent protein catabolic process
biological_process	GO:0080129	proteasome core complex assembly
biological_process	GO:0006470	protein dephosphorylation
biological_process	GO:0015031	protein transport
cellular_component	GO:0017177	glucosidase II complex
cellular_component	GO:0017059	serine C-palmitoyltransferase complex
cellular_component	GO:0005789	endoplasmic reticulum membrane
cellular_component	GO:0043231	intracellular membrane-bounded organelle
cellular_component	GO:0005618	cell wall
cellular_component	GO:0005773	vacuole
cellular_component	GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)
cellular_component	GO:0000786	nucleosome
cellular_component	GO:0031225	anchored component of membrane
cellular_component	GO:0005802	trans-Golgi network
cellular_component	GO:0000139	Golgi membrane
cellular_component	GO:0022627	cytosolic small ribosomal subunit
cellular_component	GO:0000815	ESCRT III complex
cellular_component	GO:0005840	ribosome
cellular_component	GO:0005777	peroxisome
cellular_component	GO:0005747	mitochondrial respiratory chain complex I
cellular_component	GO:0005622	intracellular
cellular_component	GO:0000325	plant-type vacuole
cellular_component	GO:0005886	plasma membrane
cellular_component	GO:0005786	signal recognition particle, endoplasmic reticulum targeting
cellular_component	GO:0005774	vacuolar membrane
cellular_component	GO:0005667	transcription factor complex
cellular_component	GO:0005759	mitochondrial matrix
cellular_component	GO:0005741	mitochondrial outer membrane
cellular_component	GO:0009507	chloroplast
cellular_component	GO:0005783	endoplasmic reticulum
cellular_component	GO:0005576	extracellular region
cellular_component	GO:0005737	cytoplasm
cellular_component	GO:0009536	plastid
cellular_component	GO:0070469	respiratory chain
cellular_component	GO:0005771	multivesicular body
cellular_component	GO:0090406	pollen tube
cellular_component	GO:0005768	endosome
cellular_component	GO:0046862	chromoplast membrane
cellular_component	GO:0031410	cytoplasmic vesicle
cellular_component	GO:0016021	integral component of membrane
cellular_component	GO:0016020	membrane
cellular_component	GO:0005794	Golgi apparatus
cellular_component	GO:0005665	DNA-directed RNA polymerase II, core complex
cellular_component	GO:0009505	plant-type cell wall
cellular_component	GO:0009707	chloroplast outer membrane
cellular_component	GO:0009506	plasmodesma
cellular_component	GO:0005779	integral component of peroxisomal membrane
cellular_component	GO:0000145	exocyst
cellular_component	GO:0005746	mitochondrial respiratory chain
cellular_component	GO:0000932	P-body
cellular_component	GO:0009579	thylakoid
cellular_component	GO:0071944	cell periphery
cellular_component	GO:0008287	protein serine/threonine phosphatase complex
cellular_component	GO:0005835	fatty acid synthase complex
cellular_component	GO:0009535	chloroplast thylakoid membrane
cellular_component	GO:0005654	nucleoplasm
cellular_component	GO:0005634	nucleus
cellular_component	GO:0044425	membrane part
cellular_component	GO:0044446	intracellular organelle part
cellular_component	GO:0009570	chloroplast stroma
cellular_component	GO:0042575	DNA polymerase complex
cellular_component	GO:0033178	proton-transporting two-sector ATPase complex, catalytic domain
cellular_component	GO:0005829	cytosol
cellular_component	GO:0045277	respiratory chain complex IV
cellular_component	GO:0005730	nucleolus
cellular_component	GO:0005795	Golgi stack
cellular_component	GO:0005739	mitochondrion
molecular_function	GO:0003951	NAD+ kinase activity
molecular_function	GO:0003993	acid phosphatase activity
molecular_function	GO:0003824	catalytic activity
molecular_function	GO:0047617	acyl-CoA hydrolase activity
molecular_function	GO:0004129	cytochrome-c oxidase activity
molecular_function	GO:0005524	ATP binding
molecular_function	GO:0004672	protein kinase activity
molecular_function	GO:0016787	hydrolase activity
molecular_function	GO:0010181	FMN binding
molecular_function	GO:0000036	acyl carrier activity
molecular_function	GO:0003723	RNA binding
molecular_function	GO:0016757	transferase activity, transferring glycosyl groups
molecular_function	GO:0030797	24-methylenesterol C-methyltransferase activity
molecular_function	GO:0003838	sterol 24-C-methyltransferase activity
molecular_function	GO:0004758	serine C-palmitoyltransferase activity
molecular_function	GO:0005515	protein binding
molecular_function	GO:0030170	pyridoxal phosphate binding
molecular_function	GO:0016295	myristoyl-[acyl-carrier-protein] hydrolase activity
molecular_function	GO:0016491	oxidoreductase activity
molecular_function	GO:0003735	structural constituent of ribosome
molecular_function	GO:0009916	alternative oxidase activity
molecular_function	GO:0005198	structural molecule activity
molecular_function	GO:0008374	O-acyltransferase activity
molecular_function	GO:0016296	palmitoyl-[acyl-carrier-protein] hydrolase activity
molecular_function	GO:0004620	phospholipase activity
molecular_function	GO:0008474	palmitoyl-(protein) hydrolase activity
molecular_function	GO:0004320	oleoyl-[acyl-carrier-protein] hydrolase activity
molecular_function	GO:0005525	GTP binding
molecular_function	GO:0004143	diacylglycerol kinase activity
molecular_function	GO:0005484	SNAP receptor activity
molecular_function	GO:0000166	nucleotide binding
molecular_function	GO:0042802	identical protein binding
molecular_function	GO:0000049	tRNA binding
molecular_function	GO:0016779	nucleotidyltransferase activity
molecular_function	GO:0004190	aspartic-type endopeptidase activity
molecular_function	GO:0004864	protein phosphatase inhibitor activity
molecular_function	GO:0016746	transferase activity, transferring acyl groups
molecular_function	GO:0004712	protein serine/threonine/tyrosine kinase activity
molecular_function	GO:0046872	metal ion binding
molecular_function	GO:0004722	protein serine/threonine phosphatase activity
molecular_function	GO:0004335	galactokinase activity
molecular_function	GO:0033858	N-acetylgalactosamine kinase activity
molecular_function	GO:0003697	single-stranded DNA binding
molecular_function	GO:0031369	translation initiation factor binding
molecular_function	GO:0008094	DNA-dependent ATPase activity
molecular_function	GO:0008308	voltage-gated anion channel activity
molecular_function	GO:0009055	electron transfer activity
molecular_function	GO:0004601	peroxidase activity
molecular_function	GO:0003743	translation initiation factor activity
molecular_function	GO:0016740	transferase activity
molecular_function	GO:0004535	poly(A)-specific ribonuclease activity
molecular_function	GO:0016783	sulfurtransferase activity
molecular_function	GO:0004808	tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity
molecular_function	GO:0003899	DNA-directed 5'-3' RNA polymerase activity
molecular_function	GO:0003700	DNA-binding transcription factor activity
molecular_function	GO:0000989	transcription factor activity, transcription factor binding
molecular_function	GO:0008233	peptidase activity
molecular_function	GO:0003727	single-stranded RNA binding
molecular_function	GO:0008270	zinc ion binding
molecular_function	GO:0005047	signal recognition particle binding
molecular_function	GO:0033926	glycopeptide alpha-N-acetylgalactosaminidase activity
molecular_function	GO:0008312	7S RNA binding
molecular_function	GO:0042626	ATPase activity, coupled to transmembrane movement of substances
molecular_function	GO:0001758	retinal dehydrogenase activity
molecular_function	GO:0004029	aldehyde dehydrogenase (NAD) activity
molecular_function	GO:0004715	non-membrane spanning protein tyrosine kinase activity
molecular_function	GO:0004674	protein serine/threonine kinase activity
molecular_function	GO:0031072	heat shock protein binding
molecular_function	GO:0051082	unfolded protein binding
molecular_function	GO:0008168	methyltransferase activity
molecular_function	GO:0004842	ubiquitin-protein transferase activity
molecular_function	GO:0016881	acid-amino acid ligase activity
molecular_function	GO:0004575	sucrose alpha-glucosidase activity
molecular_function	GO:0003676	nucleic acid binding
molecular_function	GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds
molecular_function	GO:0019843	rRNA binding
molecular_function	GO:0009881	photoreceptor activity
molecular_function	GO:0003913	DNA photolyase activity
molecular_function	GO:0004869	cysteine-type endopeptidase inhibitor activity
molecular_function	GO:0003924	GTPase activity
molecular_function	GO:0003677	DNA binding
molecular_function	GO:0046982	protein heterodimerization activity
molecular_function	GO:0004518	nuclease activity
molecular_function	GO:0003887	DNA-directed DNA polymerase activity
molecular_function	GO:0008408	3'-5' exonuclease activity
molecular_function	GO:0004798	thymidylate kinase activity
molecular_function	GO:0009041	uridylate kinase activity
molecular_function	GO:0046961	proton-transporting ATPase activity, rotational mechanism
molecular_function	GO:0046983	protein dimerization activity

RNA-Seq Expression

Co-expression


Gene	r value	Expression
Spo12894	0.99	Barchart \| Table
Spo13202	0.82	Barchart \| Table
Spo03654	0.80	Barchart \| Table
Spo01261	0.80	Barchart \| Table
Spo19874	0.79	Barchart \| Table
Spo26168	0.77	Barchart \| Table
Spo16652	0.77	Barchart \| Table
Spo13214	0.76	Barchart \| Table
Spo24857	0.76	Barchart \| Table
Spo02513	0.76	Barchart \| Table
Spo25918	0.75	Barchart \| Table
Spo02085	0.75	Barchart \| Table
Spo22256	0.75	Barchart \| Table
Spo21768	0.75	Barchart \| Table
Spo20071	0.75	Barchart \| Table
Spo00748	0.74	Barchart \| Table
Spo13029	0.74	Barchart \| Table
Spo27374	0.74	Barchart \| Table
Spo28058	0.74	Barchart \| Table
Spo05731	0.74	Barchart \| Table
Spo25230	0.74	Barchart \| Table
Spo06146	0.73	Barchart \| Table
Spo02482	0.73	Barchart \| Table
Spo18575	0.73	Barchart \| Table
Spo10316	0.73	Barchart \| Table
Spo11509	0.73	Barchart \| Table
Spo24712	0.73	Barchart \| Table
Spo07586	0.73	Barchart \| Table
Spo09290	0.73	Barchart \| Table
Spo00362	0.73	Barchart \| Table
Spo22760	0.73	Barchart \| Table
Spo17391	0.72	Barchart \| Table
Spo16339	0.72	Barchart \| Table
Spo27081	0.72	Barchart \| Table
Spo23664	0.72	Barchart \| Table
Spo06729	0.72	Barchart \| Table
Spo09499	0.72	Barchart \| Table
Spo09752	0.72	Barchart \| Table
Spo09803	0.72	Barchart \| Table
Spo10861	0.72	Barchart \| Table
Spo11733	0.72	Barchart \| Table
Spo11951	0.72	Barchart \| Table
Spo13184	0.72	Barchart \| Table
Spo13373	0.72	Barchart \| Table
Spo27102	0.72	Barchart \| Table
Spo17371	0.71	Barchart \| Table
Spo11918	0.71	Barchart \| Table
Spo17338	0.71	Barchart \| Table
Spo11098	0.71	Barchart \| Table
Spo26427	0.71	Barchart \| Table
Spo06679	0.71	Barchart \| Table
Spo13490	0.71	Barchart \| Table
Spo26811	0.71	Barchart \| Table
Spo19751	0.71	Barchart \| Table
Spo19788	0.71	Barchart \| Table
Spo15873	0.71	Barchart \| Table
Spo19738	0.71	Barchart \| Table
Spo09291	0.71	Barchart \| Table
Spo14438	0.71	Barchart \| Table
Spo06949	0.70	Barchart \| Table
Spo21351	0.70	Barchart \| Table
Spo07619	0.70	Barchart \| Table
Spo26013	0.70	Barchart \| Table
Spo01858	0.70	Barchart \| Table
Spo06004	0.70	Barchart \| Table
Spo10171	0.70	Barchart \| Table
Spo12107	0.70	Barchart \| Table
Spo01184	0.70	Barchart \| Table
Spo05955	0.70	Barchart \| Table
Spo05093	0.70	Barchart \| Table
Spo23286	0.70	Barchart \| Table
Spo00225	0.70	Barchart \| Table
Spo14942	0.70	Barchart \| Table
Spo05781	0.70	Barchart \| Table
Spo20544	0.70	Barchart \| Table
Spo06919	0.70	Barchart \| Table
Spo00283	0.69	Barchart \| Table
Spo24255	0.69	Barchart \| Table
Spo23716	0.69	Barchart \| Table
Spo17959	0.69	Barchart \| Table
Spo23588	0.69	Barchart \| Table
Spo23071	0.69	Barchart \| Table
Spo18502	0.69	Barchart \| Table
Spo10775	0.69	Barchart \| Table
Spo19850	0.69	Barchart \| Table
Spo11520	0.69	Barchart \| Table
Spo21799	0.69	Barchart \| Table
Spo14416	0.69	Barchart \| Table
Spo12176	0.69	Barchart \| Table
Spo15639	0.69	Barchart \| Table
Spo14667	0.69	Barchart \| Table
Spo03306	0.69	Barchart \| Table
Spo24796	0.69	Barchart \| Table
Spo28098	0.68	Barchart \| Table
Spo21784	0.68	Barchart \| Table
Spo16190	0.68	Barchart \| Table
Spo14678	0.68	Barchart \| Table
Spo26430	0.68	Barchart \| Table
Spo09674	0.68	Barchart \| Table
Spo21055	0.68	Barchart \| Table
Spo12376	0.68	Barchart \| Table
Spo09605	0.68	Barchart \| Table
Spo14881	0.68	Barchart \| Table
Spo22811	0.68	Barchart \| Table
Spo02484	0.68	Barchart \| Table
Spo08645	0.68	Barchart \| Table
Spo01929	0.68	Barchart \| Table
Spo08521	0.68	Barchart \| Table
Spo00257	0.68	Barchart \| Table
Spo08197	0.68	Barchart \| Table
Spo04383	0.68	Barchart \| Table
Spo27082	0.68	Barchart \| Table
Spo22028	0.68	Barchart \| Table
Spo11317	0.68	Barchart \| Table
Spo11431	0.68	Barchart \| Table
Spo18782	0.68	Barchart \| Table
Spo00878	0.68	Barchart \| Table
Spo13482	0.68	Barchart \| Table
Spo25838	0.68	Barchart \| Table
Spo27352	0.68	Barchart \| Table
Spo16804	0.67	Barchart \| Table
Spo01579	0.67	Barchart \| Table
Spo02175	0.67	Barchart \| Table
Spo02272	0.67	Barchart \| Table
Spo02643	0.67	Barchart \| Table
Spo03107	0.67	Barchart \| Table
Spo03438	0.67	Barchart \| Table
Spo05073	0.67	Barchart \| Table
Spo05405	0.67	Barchart \| Table
Spo05990	0.67	Barchart \| Table
Spo06670	0.67	Barchart \| Table
Spo06677	0.67	Barchart \| Table
Spo09772	0.67	Barchart \| Table
Spo10097	0.67	Barchart \| Table
Spo13614	0.67	Barchart \| Table
Spo13941	0.67	Barchart \| Table
Spo15630	0.67	Barchart \| Table
Spo18775	0.67	Barchart \| Table
Spo19599	0.67	Barchart \| Table
Spo19898	0.67	Barchart \| Table
Spo20770	0.67	Barchart \| Table
Spo21691	0.67	Barchart \| Table
Spo22403	0.67	Barchart \| Table
Spo22955	0.67	Barchart \| Table
Spo23527	0.67	Barchart \| Table
Spo23675	0.67	Barchart \| Table
Spo24808	0.67	Barchart \| Table
Spo25347	0.67	Barchart \| Table
Spo25876	0.67	Barchart \| Table
Spo04907	0.66	Barchart \| Table
Spo09764	0.66	Barchart \| Table
Spo09141	0.66	Barchart \| Table
Spo02107	0.66	Barchart \| Table
Spo09090	0.66	Barchart \| Table
Spo23148	0.66	Barchart \| Table
Spo08589	0.66	Barchart \| Table
Spo01840	0.66	Barchart \| Table
Spo23556	0.66	Barchart \| Table
Spo01616	0.66	Barchart \| Table
Spo06053	0.66	Barchart \| Table
Spo24566	0.66	Barchart \| Table
Spo05413	0.66	Barchart \| Table
Spo01235	0.66	Barchart \| Table
Spo05225	0.66	Barchart \| Table
Spo05127	0.66	Barchart \| Table
Spo00114	0.66	Barchart \| Table
Spo13491	0.66	Barchart \| Table
Spo04136	0.66	Barchart \| Table
Spo17250	0.66	Barchart \| Table
Spo16969	0.66	Barchart \| Table
Spo00080	0.66	Barchart \| Table
Spo18997	0.66	Barchart \| Table
Spo15084	0.66	Barchart \| Table
Spo12962	0.66	Barchart \| Table
Spo12663	0.66	Barchart \| Table
Spo20677	0.66	Barchart \| Table
Spo26768	0.66	Barchart \| Table
Spo21214	0.66	Barchart \| Table
Spo12302	0.66	Barchart \| Table
Spo21729	0.66	Barchart \| Table
Spo12029	0.66	Barchart \| Table
Spo11961	0.66	Barchart \| Table
Spo11623	0.66	Barchart \| Table
Spo11027	0.66	Barchart \| Table
Spo10360	0.66	Barchart \| Table
Spo03381	0.65	Barchart \| Table
Spo25659	0.65	Barchart \| Table
Spo03716	0.65	Barchart \| Table
Spo14537	0.65	Barchart \| Table
Spo08494	0.65	Barchart \| Table
Spo12322	0.65	Barchart \| Table
Spo21067	0.65	Barchart \| Table
Spo06465	0.65	Barchart \| Table
Spo14096	0.65	Barchart \| Table
Spo02580	0.65	Barchart \| Table
Spo06199	0.65	Barchart \| Table
Spo23751	0.65	Barchart \| Table
Spo03662	0.65	Barchart \| Table
Spo26045	0.65	Barchart \| Table
Spo05431	0.65	Barchart \| Table
Spo18185	0.65	Barchart \| Table
Spo02231	0.65	Barchart \| Table
Spo22442	0.65	Barchart \| Table
Spo15881	0.65	Barchart \| Table
Spo05306	0.65	Barchart \| Table
Spo25129	0.65	Barchart \| Table
Spo19851	0.65	Barchart \| Table
Spo01204	0.65	Barchart \| Table