Spo21046 (gene)

Overview
NameSpo21046
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
LocationSpoScf_00101 : 629289 .. 630719 (+)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: exonfive_prime_UTRpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
TTGGTTTTAATCCCATTAATTAGAAATTTAGAATCCTTCAAAAAAAAGTCCCATTAATTAGAATCCTAATTACAATTTGCAAACCCCCTTCAAATCTCCCAAGAACAGAAAAGGTGTAAAAAAAAAAAAAAAAAAAAAAACCCAAAACCATGAAAACACAAAACTTGTGCACCTCCTCACACTCTCTCTCTTCCAATCTACGTCTCTTTCTAACCCACTTTAATGGCGATTACAAAATCCTTAATTCTCATAAATATTAATCATAGAATCTCCATTGTAATCTCCTTTCTCTCTGTTTTCTGTCACTCCTTTTCTTTCTTCCTTCCTCACTTCTTCACTCAACCTTGCTCTTTTTGTTCCGTTCTTCTACTTTTTTTAGCCTTCTCTTGCAGTTTTTGCTTCATATTTTCCTGCAATTTCAGGTATGCTTCGATTTTATTCACGCATTTTTCAAGTTTCAATTTCTGGGTTTTGTTTTATTTGAGTTTTGAATTTCTGTGTTTTGTTGTTTGTCATAGTGGTTATTTTGTTCGTTTATTGCCCTGAAAAAAATTATCGATTTTTATATTGAACTAAAATATTGAATATGGAAGTTTTCTGGGTAATATATGATGTTCGGTTGAGTTTTGAGTCTTTTGACAGTGGTAGAAGTTCACATTTATTTAATTTCAAATATAATAGAATTATTAAAAAAGGACAAAGTTGAGATTGTATGTTAGTGTTACCAGCATGATGATCTACAATAAGCTGTGTTTATGGGTTGTGCCATGTTATGGGGGAAATAAATAAATAAATATAATCTGACATACATGGAAAGAAAAAGGGCTGTTACTTGTGAAAATATTCTTCTATATGGTAATGAATCACTAGGTTGATTATATATTTATATTATATAGTTTCAATATTAATTAATTAATTAACTATGGAGGTTATAATAATAATTAATTGAGGGATTAATGTAAGATCCAGTTTGCTGATTTTTTTAATTGTGTACATTACCATAATTGGTCTAGATCAACATGGTGGGAGGGAGGGTCCTTCTTCTCATTCAGACGTTATAAAGAGGAGACTTTTCTTATTTATTTATTTGTTCTTGCTTGATTGTTTTTTTTTTGGATGAAGAATTCATCATCATCAACTGTAGATTTCTGGTACTAATTCAAAGGTGTTTGCTTTTGACTAGTCAACCTTCCGTCAATGTTGTATCAATATATAAGTTGAATTGCTTTGTATAAATGTAATTCACATCTGTGAGTTGTGAGTGTGTCTTGCAAAACTTGTCATTGTAATTTTTTCATTGTCGATTTCGAGCTTATTCAAATCTTGTAAGATATTCTGTCTAATGCTGGAATAGTTTACAGGAAGGAGTTACAGCAAGCATCTGGATTAGTTCTCAGGGCTGTTTATCTGACGGTTTTTCGGTCAAGATAG

mRNA sequence

TTGGTTTTAATCCCATTAATTAGAAATTTAGAATCCTTCAAAAAAAAGTCCCATTAATTAGAATCCTAATTACAATTTGCAAACCCCCTTCAAATCTCCCAAGAACAGAAAAGGTGTAAAAAAAAAAAAAAAAAAAAAAACCCAAAACCATGAAAACACAAAACTTGTGCACCTCCTCACACTCTCTCTCTTCCAATCTACGTCTCTTTCTAACCCACTTTAATGGCGATTACAAAATCCTTAATTCTCATAAATATTAATCATAGAATCTCCATTGTAATCTCCTTTCTCTCTGTTTTCTGTCACTCCTTTTCTTTCTTCCTTCCTCACTTCTTCACTCAACCTTGCTCTTTTTGTTCCGTTCTTCTACTTTTTTTAGCCTTCTCTTGCAGTTTTTGCTTCATATTTTCCTGCAATTTCAGGAAGGAGTTACAGCAAGCATCTGGATTAGTTCTCAGGGCTGTTTATCTGACGGTTTTTCGGTCAAGATAG

Coding sequence (CDS)

ATGGCGATTACAAAATCCTTAATTCTCATAAATATTAATCATAGAATCTCCATTGTAATCTCCTTTCTCTCTGTTTTCTGTCACTCCTTTTCTTTCTTCCTTCCTCACTTCTTCACTCAACCTTGCTCTTTTTGTTCCGTTCTTCTACTTTTTTTAGCCTTCTCTTGCAGTTTTTGCTTCATATTTTCCTGCAATTTCAGGAAGGAGTTACAGCAAGCATCTGGATTAGTTCTCAGGGCTGTTTATCTGACGGTTTTTCGGTCAAGATAG

Protein sequence

MAITKSLILININHRISIVISFLSVFCHSFSFFLPHFFTQPCSFCSVLLLFLAFSCSFCFIFSCNFRKELQQASGLVLRAVYLTVFRSR
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo21046.1Spo21046.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo21046.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo21046.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo21046.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo21046.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0006633 fatty acid biosynthetic process
biological_process GO:0032957 inositol trisphosphate metabolic process
biological_process GO:0009695 jasmonic acid biosynthetic process
biological_process GO:0032259 methylation
biological_process GO:0016310 phosphorylation
biological_process GO:0009620 response to fungus
biological_process GO:0009753 response to jasmonic acid
biological_process GO:0009611 response to wounding
biological_process GO:0016192 vesicle-mediated transport
biological_process GO:0010286 heat acclimation
biological_process GO:0042967 obsolete acyl-carrier-protein biosynthetic process
biological_process GO:0015996 chlorophyll catabolic process
biological_process GO:0010264 myo-inositol hexakisphosphate biosynthetic process
biological_process GO:0006098 pentose-phosphate shunt
biological_process GO:0010027 thylakoid membrane organization
biological_process GO:0019521 D-gluconate metabolic process
biological_process GO:0043069 negative regulation of programmed cell death
biological_process GO:0018279 protein N-linked glycosylation via asparagine
biological_process GO:0009073 aromatic amino acid family biosynthetic process
biological_process GO:0016117 carotenoid biosynthetic process
biological_process GO:0030154 cell differentiation
biological_process GO:0015995 chlorophyll biosynthetic process
biological_process GO:0006621 protein retention in ER lumen
biological_process GO:0008152 metabolic process
biological_process GO:0009965 leaf morphogenesis
biological_process GO:0009744 response to sucrose
biological_process GO:0009735 response to cytokinin
biological_process GO:0019432 triglyceride biosynthetic process
biological_process GO:0006526 arginine biosynthetic process
biological_process GO:0006591 ornithine metabolic process
biological_process GO:0048481 plant ovule development
biological_process GO:0006560 proline metabolic process
biological_process GO:0006164 purine nucleotide biosynthetic process
biological_process GO:0009723 response to ethylene
biological_process GO:0009750 response to fructose
biological_process GO:0009749 response to glucose
biological_process GO:0016049 cell growth
biological_process GO:0010103 stomatal complex morphogenesis
biological_process GO:0000902 cell morphogenesis
biological_process GO:0090503 RNA phosphodiester bond hydrolysis, exonucleolytic
biological_process GO:0010228 vegetative to reproductive phase transition of meristem
biological_process GO:0009853 photorespiration
biological_process GO:0006508 proteolysis
biological_process GO:0006465 signal peptide processing
biological_process GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
biological_process GO:0000023 maltose metabolic process
biological_process GO:0045893 positive regulation of transcription, DNA-templated
biological_process GO:0019252 starch biosynthetic process
biological_process GO:0019344 cysteine biosynthetic process
biological_process GO:0006655 phosphatidylglycerol biosynthetic process
biological_process GO:0006631 fatty acid metabolic process
biological_process GO:1901576 organic substance biosynthetic process
biological_process GO:0016114 terpenoid biosynthetic process
biological_process GO:0035556 intracellular signal transduction
biological_process GO:0006891 intra-Golgi vesicle-mediated transport
biological_process GO:0006468 protein phosphorylation
biological_process GO:0019752 carboxylic acid metabolic process
biological_process GO:0009056 catabolic process
biological_process GO:0044249 cellular biosynthetic process
biological_process GO:0006662 glycerol ether metabolic process
biological_process GO:0042430 indole-containing compound metabolic process
biological_process GO:1901575 organic substance catabolic process
biological_process GO:0006661 phosphatidylinositol biosynthetic process
biological_process GO:0050790 regulation of catalytic activity
biological_process GO:0009423 chorismate biosynthetic process
biological_process GO:0009094 L-phenylalanine biosynthetic process
biological_process GO:0033587 shikimate biosynthetic process
biological_process GO:0000162 tryptophan biosynthetic process
biological_process GO:0006571 tyrosine biosynthetic process
biological_process GO:0009738 abscisic acid-activated signaling pathway
biological_process GO:0030968 endoplasmic reticulum unfolded protein response
biological_process GO:0010200 response to chitin
biological_process GO:0006446 regulation of translational initiation
biological_process GO:0006694 steroid biosynthetic process
biological_process GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
biological_process GO:0010155 regulation of proton transport
biological_process GO:0009773 photosynthetic electron transport in photosystem I
biological_process GO:0009637 response to blue light
biological_process GO:0010218 response to far red light
biological_process GO:0009644 response to high light intensity
biological_process GO:0010114 response to red light
biological_process GO:0006364 rRNA processing
biological_process GO:0006744 ubiquinone biosynthetic process
biological_process GO:0006636 unsaturated fatty acid biosynthetic process
biological_process GO:0045454 cell redox homeostasis
biological_process GO:0019761 glucosinolate biosynthetic process
biological_process GO:0019497 hexachlorocyclohexane metabolic process
biological_process GO:0010207 photosystem II assembly
biological_process GO:0045892 negative regulation of transcription, DNA-templated
biological_process GO:0010206 photosystem II repair
biological_process GO:0009657 plastid organization
biological_process GO:0035304 regulation of protein dephosphorylation
biological_process GO:0006771 riboflavin metabolic process
biological_process GO:0015991 ATP hydrolysis coupled proton transport
biological_process GO:0005975 carbohydrate metabolic process
biological_process GO:0044262 cellular carbohydrate metabolic process
biological_process GO:0044260 cellular macromolecule metabolic process
biological_process GO:0009987 cellular process
biological_process GO:0006457 protein folding
biological_process GO:0015671 oxygen transport
biological_process GO:0016311 dephosphorylation
biological_process GO:0009627 systemic acquired resistance
biological_process GO:0050896 response to stimulus
biological_process GO:0016226 iron-sulfur cluster assembly
biological_process GO:0010582 floral meristem determinacy
biological_process GO:0030244 cellulose biosynthetic process
biological_process GO:0009850 auxin metabolic process
biological_process GO:0009734 auxin-activated signaling pathway
biological_process GO:0009887 animal organ morphogenesis
biological_process GO:0010158 abaxial cell fate specification
biological_process GO:0043085 positive regulation of catalytic activity
biological_process GO:0051176 positive regulation of sulfur metabolic process
biological_process GO:0010075 regulation of meristem growth
biological_process GO:0009058 biosynthetic process
biological_process GO:0009755 hormone-mediated signaling pathway
biological_process GO:0043407 negative regulation of MAP kinase activity
biological_process GO:0035335 peptidyl-tyrosine dephosphorylation
biological_process GO:0009737 response to abscisic acid
biological_process GO:0048439 flower morphogenesis
biological_process GO:0009733 response to auxin
biological_process GO:0010363 regulation of plant-type hypersensitive response
biological_process GO:0006612 protein targeting to membrane
biological_process GO:0009963 positive regulation of flavonoid biosynthetic process
biological_process GO:0006570 tyrosine metabolic process
biological_process GO:0042255 ribosome assembly
biological_process GO:0009944 polarity specification of adaxial/abaxial axis
biological_process GO:0016559 peroxisome fission
biological_process GO:0031347 regulation of defense response
biological_process GO:0009855 determination of bilateral symmetry
biological_process GO:0006913 nucleocytoplasmic transport
biological_process GO:0010014 meristem initiation
biological_process GO:0006886 intracellular protein transport
biological_process GO:0044375 regulation of peroxisome size
biological_process GO:0007264 small GTPase mediated signal transduction
biological_process GO:0048438 floral whorl development
biological_process GO:0015979 photosynthesis
biological_process GO:0006623 protein targeting to vacuole
biological_process GO:0046034 ATP metabolic process
biological_process GO:0046939 nucleotide phosphorylation
biological_process GO:0006144 purine nucleobase metabolic process
biological_process GO:0009767 photosynthetic electron transport chain
biological_process GO:0009651 response to salt stress
biological_process GO:0055085 transmembrane transport
biological_process GO:0007033 vacuole organization
biological_process GO:0080005 photosystem stoichiometry adjustment
biological_process GO:0006470 protein dephosphorylation
biological_process GO:0007030 Golgi organization
biological_process GO:1902600 proton transmembrane transport
biological_process GO:0006007 glucose catabolic process
biological_process GO:0010051 xylem and phloem pattern formation
biological_process GO:0009616 virus induced gene silencing
biological_process GO:0006816 calcium ion transport
biological_process GO:0010050 vegetative phase change
biological_process GO:0046686 response to cadmium ion
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0048519 negative regulation of biological process
biological_process GO:0048193 Golgi vesicle transport
cellular_component GO:0009512 cytochrome b6f complex
cellular_component GO:0033179 proton-transporting V-type ATPase, V0 domain
cellular_component GO:0008250 oligosaccharyltransferase complex
cellular_component GO:0044464 cell part
cellular_component GO:0009579 thylakoid
cellular_component GO:0031977 thylakoid lumen
cellular_component GO:0005779 integral component of peroxisomal membrane
cellular_component GO:0005794 Golgi apparatus
cellular_component GO:0000325 plant-type vacuole
cellular_component GO:0005774 vacuolar membrane
cellular_component GO:0005886 plasma membrane
cellular_component GO:0009507 chloroplast
cellular_component GO:0005622 intracellular
cellular_component GO:0045277 respiratory chain complex IV
cellular_component GO:0008287 protein serine/threonine phosphatase complex
cellular_component GO:0031410 cytoplasmic vesicle
cellular_component GO:0009506 plasmodesma
cellular_component GO:0044425 membrane part
cellular_component GO:0005840 ribosome
cellular_component GO:0005730 nucleolus
cellular_component GO:0009570 chloroplast stroma
cellular_component GO:0005737 cytoplasm
cellular_component GO:0005747 mitochondrial respiratory chain complex I
cellular_component GO:0009523 photosystem II
cellular_component GO:0005802 trans-Golgi network
cellular_component GO:0009348 ornithine carbamoyltransferase complex
cellular_component GO:0005768 endosome
cellular_component GO:0005667 transcription factor complex
cellular_component GO:0005795 Golgi stack
cellular_component GO:0005829 cytosol
cellular_component GO:0005746 mitochondrial respiratory chain
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0005787 signal peptidase complex
cellular_component GO:0044434 chloroplast part
cellular_component GO:0005835 fatty acid synthase complex
cellular_component GO:0005777 peroxisome
cellular_component GO:0005634 nucleus
cellular_component GO:0010287 plastoglobule
cellular_component GO:0005789 endoplasmic reticulum membrane
cellular_component GO:0009535 chloroplast thylakoid membrane
cellular_component GO:0009941 chloroplast envelope
cellular_component GO:0005739 mitochondrion
cellular_component GO:0005783 endoplasmic reticulum
cellular_component GO:0016020 membrane
cellular_component GO:0005856 cytoskeleton
molecular_function GO:0003779 actin binding
molecular_function GO:0003924 GTPase activity
molecular_function GO:0004672 protein kinase activity
molecular_function GO:0003743 translation initiation factor activity
molecular_function GO:0047617 acyl-CoA hydrolase activity
molecular_function GO:0010181 FMN binding
molecular_function GO:0008234 cysteine-type peptidase activity
molecular_function GO:0051996 squalene synthase activity
molecular_function GO:0003856 3-dehydroquinate synthase activity
molecular_function GO:0004310 farnesyl-diphosphate farnesyltransferase activity
molecular_function GO:0004017 adenylate kinase activity
molecular_function GO:0005515 protein binding
molecular_function GO:0005524 ATP binding
molecular_function GO:0016787 hydrolase activity
molecular_function GO:0004129 cytochrome-c oxidase activity
molecular_function GO:0050660 flavin adenine dinucleotide binding
molecular_function GO:0030246 carbohydrate binding
molecular_function GO:0015035 protein disulfide oxidoreductase activity
molecular_function GO:0030234 enzyme regulator activity
molecular_function GO:0003723 RNA binding
molecular_function GO:0004725 protein tyrosine phosphatase activity
molecular_function GO:0005525 GTP binding
molecular_function GO:0016597 amino acid binding
molecular_function GO:0046923 ER retention sequence binding
molecular_function GO:0016746 transferase activity, transferring acyl groups
molecular_function GO:0030170 pyridoxal phosphate binding
molecular_function GO:0016829 lyase activity
molecular_function GO:0008233 peptidase activity
molecular_function GO:0016740 transferase activity
molecular_function GO:0016866 intramolecular transferase activity
molecular_function GO:0004585 ornithine carbamoyltransferase activity
molecular_function GO:0003677 DNA binding
molecular_function GO:0052725 inositol-1,3,4-trisphosphate 6-kinase activity
molecular_function GO:0003700 DNA-binding transcription factor activity
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0005344 oxygen carrier activity
molecular_function GO:0019825 oxygen binding
molecular_function GO:0005506 iron ion binding
molecular_function GO:0020037 heme binding
molecular_function GO:0004722 protein serine/threonine phosphatase activity
molecular_function GO:0046872 metal ion binding
molecular_function GO:0052726 inositol-1,3,4-trisphosphate 5-kinase activity
molecular_function GO:0047325 inositol tetrakisphosphate 1-kinase activity
molecular_function GO:0015078 proton transmembrane transporter activity
molecular_function GO:0016757 transferase activity, transferring glycosyl groups
molecular_function GO:0003993 acid phosphatase activity
molecular_function GO:0042626 ATPase activity, coupled to transmembrane movement of substances
molecular_function GO:0051087 chaperone binding
molecular_function GO:0008430 selenium binding
molecular_function GO:0031072 heat shock protein binding
molecular_function GO:0008685 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity
molecular_function GO:0051082 unfolded protein binding
molecular_function GO:0008047 enzyme activator activity
molecular_function GO:0008138 protein tyrosine/serine/threonine phosphatase activity
molecular_function GO:0000287 magnesium ion binding
molecular_function GO:0004579 dolichyl-diphosphooligosaccharide-protein glycotransferase activity
molecular_function GO:0004616 phosphogluconate dehydrogenase (decarboxylating) activity
molecular_function GO:0050661 NADP binding
molecular_function GO:0051287 NAD binding
molecular_function GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
molecular_function GO:0042802 identical protein binding
molecular_function GO:0005484 SNAP receptor activity
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0008168 methyltransferase activity
molecular_function GO:0004535 poly(A)-specific ribonuclease activity
RNA-Seq Expression
   



Co-expression
Gener valueExpression
Spo228110.78Barchart | Table
Spo160790.77Barchart | Table
Spo113170.76Barchart | Table
Spo167970.75Barchart | Table
Spo225830.75Barchart | Table
Spo240460.74Barchart | Table
Spo012610.74Barchart | Table
Spo062930.74Barchart | Table
Spo235490.74Barchart | Table
Spo014480.74Barchart | Table
Spo270810.73Barchart | Table
Spo205440.73Barchart | Table
Spo134900.73Barchart | Table
Spo088500.73Barchart | Table
Spo081140.73Barchart | Table
Spo123540.73Barchart | Table
Spo026280.72Barchart | Table
Spo166950.72Barchart | Table
Spo102350.72Barchart | Table
Spo093350.72Barchart | Table
Spo060040.72Barchart | Table
Spo032510.72Barchart | Table
Spo119610.72Barchart | Table
Spo208690.72Barchart | Table
Spo169110.71Barchart | Table
Spo095540.71Barchart | Table
Spo142250.71Barchart | Table
Spo019250.71Barchart | Table
Spo237120.71Barchart | Table
Spo123020.71Barchart | Table
Spo050730.71Barchart | Table
Spo019340.71Barchart | Table
Spo061640.71Barchart | Table
Spo016860.70Barchart | Table
Spo154610.70Barchart | Table
Spo081970.70Barchart | Table
Spo162130.70Barchart | Table
Spo252300.70Barchart | Table
Spo028130.70Barchart | Table
Spo258760.69Barchart | Table
Spo211440.69Barchart | Table
Spo212150.69Barchart | Table
Spo046530.69Barchart | Table
Spo235180.69Barchart | Table
Spo048680.69Barchart | Table
Spo269860.69Barchart | Table
Spo076190.69Barchart | Table
Spo018580.69Barchart | Table
Spo108150.69Barchart | Table
Spo114460.69Barchart | Table
Spo024800.69Barchart | Table
Spo025730.69Barchart | Table
Spo146780.69Barchart | Table
Spo149420.69Barchart | Table
Spo175780.69Barchart | Table
Spo035720.69Barchart | Table
Spo010540.69Barchart | Table
Spo028900.68Barchart | Table
Spo238570.68Barchart | Table
Spo109400.68Barchart | Table
Spo216600.68Barchart | Table
Spo025130.68Barchart | Table
Spo256590.68Barchart | Table
Spo209120.68Barchart | Table
Spo026960.68Barchart | Table
Spo017140.68Barchart | Table
Spo083510.68Barchart | Table
Spo108640.68Barchart | Table
Spo226830.68Barchart | Table
Spo132090.68Barchart | Table
Spo216910.68Barchart | Table
Spo169960.68Barchart | Table
Spo185020.67Barchart | Table
Spo151740.67Barchart | Table
Spo220520.67Barchart | Table
Spo156390.67Barchart | Table
Spo158730.67Barchart | Table
Spo217310.67Barchart | Table
Spo029320.67Barchart | Table
Spo253900.67Barchart | Table
Spo211550.67Barchart | Table
Spo087130.67Barchart | Table
Spo089970.67Barchart | Table
Spo076090.67Barchart | Table
Spo271020.67Barchart | Table
Spo059230.67Barchart | Table
Spo264300.67Barchart | Table
Spo103730.67Barchart | Table
Spo014370.67Barchart | Table
Spo172500.67Barchart | Table
Spo115090.67Barchart | Table
Spo185780.67Barchart | Table
Spo054020.67Barchart | Table
Spo251590.67Barchart | Table
Spo244250.67Barchart | Table
Spo123700.67Barchart | Table
Spo198700.67Barchart | Table
Spo133930.67Barchart | Table
Spo280580.67Barchart | Table
Spo227600.67Barchart | Table
Spo003440.67Barchart | Table
Spo181950.67Barchart | Table
Spo162400.66Barchart | Table
Spo012430.66Barchart | Table
Spo037570.66Barchart | Table
Spo038670.66Barchart | Table
Spo054310.66Barchart | Table
Spo057310.66Barchart | Table
Spo062940.66Barchart | Table
Spo083390.66Barchart | Table
Spo086450.66Barchart | Table
Spo089350.66Barchart | Table
Spo096050.66Barchart | Table
Spo096710.66Barchart | Table
Spo115240.66Barchart | Table
Spo130290.66Barchart | Table
Spo130630.66Barchart | Table
Spo133730.66Barchart | Table
Spo140870.66Barchart | Table
Spo144160.66Barchart | Table
Spo000790.66Barchart | Table
Spo162930.66Barchart | Table
Spo176100.66Barchart | Table
Spo188750.66Barchart | Table
Spo192170.66Barchart | Table
Spo198360.66Barchart | Table
Spo229550.66Barchart | Table
Spo233840.66Barchart | Table
Spo256530.66Barchart | Table
Spo259180.66Barchart | Table
Spo267890.66Barchart | Table
Spo270620.66Barchart | Table
Spo146670.65Barchart | Table
Spo061460.65Barchart | Table
Spo102840.65Barchart | Table
Spo060310.65Barchart | Table
Spo066700.65Barchart | Table
Spo231580.65Barchart | Table
Spo166410.65Barchart | Table
Spo043830.65Barchart | Table
Spo154470.65Barchart | Table