Spo23263 (gene)

Overview
NameSpo23263
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
Locationchr6 : 44308260 .. 44308671 (-)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexonthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGCTTATTGAACTGTTCTGTTATAGTCTACGCGTCTATATAGTGTATACATGCTTCTGTGATTGCAACTTCAATTAAGACTTTTAAAGCAGTTTACTTATTCTCTAGAAAACTTTGATGGTGTCTTCTTTGTTTGTTGTCATGTTATTTTTTGTCGTCTTGGAACACAGGTAGGTACTTTGCAACGAGGAACGCCTAATCTACAAATCAGTAGGAAAATTGGACTGTCTTAGTGAGTGTAAGGTTTAGTAGTTGTTATAGTACCACATTATCTTCTGTTATGAAGCTCTAAGCAAGGTCATTACCCTTGTTCACTCAAGTATCGAAAACAAACTCTAAGAAGACGAATCAGTTGATTGAAGAATCAAAGCTTGAAGAAAACGAAACTTGGAAGTTCTGTTGTAAATTATGA

mRNA sequence

ATGCTTATTGAACTGTTCTGTTATAGTCTACGCGTAGGTACTTTGCAACGAGGAACGCCTAATCTACAAATCAGTAGGAAAATTGGACTGTCTTAGTCATTACCCTTGTTCACTCAAGTATCGAAAACAAACTCTAAGAAGACGAATCAGTTGATTGAAGAATCAAAGCTTGAAGAAAACGAAACTTGGAAGTTCTGTTGTAAATTATGA

Coding sequence (CDS)

ATGCTTATTGAACTGTTCTGTTATAGTCTACGCGTAGGTACTTTGCAACGAGGAACGCCTAATCTACAAATCAGTAGGAAAATTGGACTGTCTTAG

Protein sequence

MLIELFCYSLRVGTLQRGTPNLQISRKIGLS
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo23263.1Spo23263.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo23263.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo23263.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo23263.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo23263.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0051301 cell division
biological_process GO:0010050 vegetative phase change
biological_process GO:0030261 chromosome condensation
biological_process GO:0035196 production of miRNAs involved in gene silencing by miRNA
biological_process GO:0010267 production of ta-siRNAs involved in RNA interference
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation
biological_process GO:0006366 transcription by RNA polymerase II
biological_process GO:0010228 vegetative to reproductive phase transition of meristem
biological_process GO:0010073 meristem maintenance
biological_process GO:0009616 virus induced gene silencing
biological_process GO:0010051 xylem and phloem pattern formation
biological_process GO:0044260 cellular macromolecule metabolic process
biological_process GO:0009408 response to heat
biological_process GO:0006560 proline metabolic process
biological_process GO:0033388 putrescine biosynthetic process from arginine
biological_process GO:0006346 methylation-dependent chromatin silencing
biological_process GO:0010014 meristem initiation
biological_process GO:0009791 post-embryonic development
biological_process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
biological_process GO:0010048 vernalization response
biological_process GO:0042761 very long-chain fatty acid biosynthetic process
biological_process GO:0016197 endosomal transport
biological_process GO:0061025 membrane fusion
biological_process GO:0008284 positive regulation of cell proliferation
biological_process GO:0043248 proteasome assembly
biological_process GO:0006623 protein targeting to vacuole
biological_process GO:0048439 flower morphogenesis
biological_process GO:0051788 response to misfolded protein
biological_process GO:0009610 response to symbiotic fungus
biological_process GO:0009887 animal organ morphogenesis
biological_process GO:0007267 cell-cell signaling
biological_process GO:0009855 determination of bilateral symmetry
biological_process GO:0006306 DNA methylation
biological_process GO:0006260 DNA replication
biological_process GO:0000956 nuclear-transcribed mRNA catabolic process
biological_process GO:0032527 protein exit from endoplasmic reticulum
biological_process GO:0000413 protein peptidyl-prolyl isomerization
biological_process GO:0006289 nucleotide-excision repair
biological_process GO:0006574 valine catabolic process
biological_process GO:0006887 exocytosis
biological_process GO:0006312 mitotic recombination
biological_process GO:0016070 RNA metabolic process
biological_process GO:0019430 removal of superoxide radicals
biological_process GO:0032508 DNA duplex unwinding
biological_process GO:0051252 regulation of RNA metabolic process
biological_process GO:0006552 leucine catabolic process
biological_process GO:0006396 RNA processing
biological_process GO:0045010 actin nucleation
biological_process GO:0007155 cell adhesion
biological_process GO:0010090 trichome morphogenesis
biological_process GO:0015031 protein transport
biological_process GO:0042147 retrograde transport, endosome to Golgi
biological_process GO:0006098 pentose-phosphate shunt
biological_process GO:0006550 isoleucine catabolic process
biological_process GO:0006486 protein glycosylation
biological_process GO:1901700 response to oxygen-containing compound
biological_process GO:0009639 response to red or far red light
biological_process GO:0007033 vacuole organization
biological_process GO:0048280 vesicle fusion with Golgi apparatus
biological_process GO:0006810 transport
biological_process GO:0009719 response to endogenous stimulus
biological_process GO:0010033 response to organic substance
biological_process GO:0051607 defense response to virus
biological_process GO:0019521 D-gluconate metabolic process
biological_process GO:0006370 7-methylguanosine mRNA capping
biological_process GO:0006266 DNA ligation
biological_process GO:0035335 peptidyl-tyrosine dephosphorylation
biological_process GO:0098507 polynucleotide 5' dephosphorylation
biological_process GO:0006570 tyrosine metabolic process
biological_process GO:0016567 protein ubiquitination
biological_process GO:0048767 root hair elongation
biological_process GO:0009826 unidimensional cell growth
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0006457 protein folding
biological_process GO:0000226 microtubule cytoskeleton organization
biological_process GO:0018342 protein prenylation
biological_process GO:0018345 protein palmitoylation
biological_process GO:0048527 lateral root development
biological_process GO:0007186 G-protein coupled receptor signaling pathway
biological_process GO:0006308 DNA catabolic process
biological_process GO:0010540 basipetal auxin transport
biological_process GO:0006511 ubiquitin-dependent protein catabolic process
biological_process GO:0016192 vesicle-mediated transport
biological_process GO:0050790 regulation of catalytic activity
biological_process GO:0006886 intracellular protein transport
biological_process GO:0008152 metabolic process
biological_process GO:0009560 embryo sac egg cell differentiation
biological_process GO:0007165 signal transduction
biological_process GO:0009069 serine family amino acid metabolic process
biological_process GO:0006468 protein phosphorylation
biological_process GO:0031047 gene silencing by RNA
biological_process GO:0009395 phospholipid catabolic process
biological_process GO:0035556 intracellular signal transduction
biological_process GO:0046339 diacylglycerol metabolic process
biological_process GO:0007064 mitotic sister chromatid cohesion
biological_process GO:0051321 meiotic cell cycle
biological_process GO:0006281 DNA repair
biological_process GO:0006310 DNA recombination
biological_process GO:0009845 seed germination
biological_process GO:0044238 primary metabolic process
biological_process GO:0006397 mRNA processing
biological_process GO:0046854 phosphatidylinositol phosphorylation
biological_process GO:0009987 cellular process
biological_process GO:0043412 macromolecule modification
biological_process GO:0042967 obsolete acyl-carrier-protein biosynthetic process
biological_process GO:0009736 cytokinin-activated signaling pathway
biological_process GO:0065007 biological regulation
biological_process GO:0030010 establishment of cell polarity
biological_process GO:0009880 embryonic pattern specification
biological_process GO:0048015 phosphatidylinositol-mediated signaling
biological_process GO:0030154 cell differentiation
biological_process GO:0000911 cytokinesis by cell plate formation
biological_process GO:0006661 phosphatidylinositol biosynthetic process
biological_process GO:0009734 auxin-activated signaling pathway
cellular_component GO:0005739 mitochondrion
cellular_component GO:0005759 mitochondrial matrix
cellular_component GO:0005886 plasma membrane
cellular_component GO:0016459 myosin complex
cellular_component GO:0009524 phragmoplast
cellular_component GO:0016363 nuclear matrix
cellular_component GO:0000775 chromosome, centromeric region
cellular_component GO:0005856 cytoskeleton
cellular_component GO:0005819 spindle
cellular_component GO:0005789 endoplasmic reticulum membrane
cellular_component GO:0005737 cytoplasm
cellular_component GO:0000145 exocyst
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0005795 Golgi stack
cellular_component GO:0000139 Golgi membrane
cellular_component GO:0005829 cytosol
cellular_component GO:0009506 plasmodesma
cellular_component GO:0005719 nuclear euchromatin
cellular_component GO:0005667 transcription factor complex
cellular_component GO:0031902 late endosome membrane
cellular_component GO:0000785 chromatin
cellular_component GO:0043231 intracellular membrane-bounded organelle
cellular_component GO:0044444 cytoplasmic part
cellular_component GO:0005794 Golgi apparatus
cellular_component GO:0035101 FACT complex
cellular_component GO:0005834 heterotrimeric G-protein complex
cellular_component GO:0008278 cohesin complex
cellular_component GO:0005634 nucleus
cellular_component GO:0030904 retromer complex
cellular_component GO:0031461 cullin-RING ubiquitin ligase complex
cellular_component GO:0005657 replication fork
molecular_function GO:0016832 aldehyde-lyase activity
molecular_function GO:0051287 NAD binding
molecular_function GO:0004616 phosphogluconate dehydrogenase (decarboxylating) activity
molecular_function GO:0003755 peptidyl-prolyl cis-trans isomerase activity
molecular_function GO:0035091 phosphatidylinositol binding
molecular_function GO:0008442 3-hydroxyisobutyrate dehydrogenase activity
molecular_function GO:0003682 chromatin binding
molecular_function GO:0003690 double-stranded DNA binding
molecular_function GO:0005524 ATP binding
molecular_function GO:0004525 ribonuclease III activity
molecular_function GO:0008270 zinc ion binding
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0097159 organic cyclic compound binding
molecular_function GO:0046982 protein heterodimerization activity
molecular_function GO:0004003 ATP-dependent DNA helicase activity
molecular_function GO:0004784 superoxide dismutase activity
molecular_function GO:0004435 phosphatidylinositol phospholipase C activity
molecular_function GO:0004871 obsolete signal transducer activity
molecular_function GO:0008080 N-acetyltransferase activity
molecular_function GO:0005515 protein binding
molecular_function GO:0031072 heat shock protein binding
molecular_function GO:0046872 metal ion binding
molecular_function GO:0004668 protein-arginine deiminase activity
molecular_function GO:0047632 agmatine deiminase activity
molecular_function GO:0016740 transferase activity
molecular_function GO:0016779 nucleotidyltransferase activity
molecular_function GO:0051082 unfolded protein binding
molecular_function GO:0005509 calcium ion binding
molecular_function GO:0005488 binding
molecular_function GO:0017111 nucleoside-triphosphatase activity
molecular_function GO:0004430 1-phosphatidylinositol 4-kinase activity
molecular_function GO:0003700 DNA-binding transcription factor activity
molecular_function GO:0032440 2-alkenal reductase [NAD(P)] activity
molecular_function GO:0003677 DNA binding
molecular_function GO:0008026 ATP-dependent helicase activity
molecular_function GO:0004672 protein kinase activity
molecular_function GO:0031625 ubiquitin protein ligase binding
molecular_function GO:0030695 GTPase regulator activity
molecular_function GO:0016772 transferase activity, transferring phosphorus-containing groups
molecular_function GO:0003910 DNA ligase (ATP) activity
molecular_function GO:0050660 flavin adenine dinucleotide binding
molecular_function GO:0003995 acyl-CoA dehydrogenase activity
molecular_function GO:0008138 protein tyrosine/serine/threonine phosphatase activity
molecular_function GO:0004725 protein tyrosine phosphatase activity
molecular_function GO:0004651 polynucleotide 5'-phosphatase activity
molecular_function GO:0004484 mRNA guanylyltransferase activity
molecular_function GO:0000166 nucleotide binding
molecular_function GO:0003723 RNA binding
molecular_function GO:0004674 protein serine/threonine kinase activity
molecular_function GO:0036459 thiol-dependent ubiquitinyl hydrolase activity
molecular_function GO:0008234 cysteine-type peptidase activity
molecular_function GO:0016746 transferase activity, transferring acyl groups
molecular_function GO:0003779 actin binding
molecular_function GO:0043167 ion binding
molecular_function GO:0008565 protein transporter activity
molecular_function GO:0003774 motor activity
RNA-Seq Expression
   



Co-expression
Gener valueExpression
Spo171230.74Barchart | Table
Spo002990.73Barchart | Table
Spo011460.72Barchart | Table
Spo076000.71Barchart | Table
Spo076940.71Barchart | Table
Spo007830.71Barchart | Table
Spo208260.71Barchart | Table
Spo250130.71Barchart | Table
Spo224580.71Barchart | Table
Spo056700.71Barchart | Table
Spo062910.71Barchart | Table
Spo191260.71Barchart | Table
Spo170980.70Barchart | Table
Spo171900.70Barchart | Table
Spo077000.70Barchart | Table
Spo023470.70Barchart | Table
Spo117590.70Barchart | Table
Spo031970.70Barchart | Table
Spo254970.69Barchart | Table
Spo244680.69Barchart | Table
Spo089630.69Barchart | Table
Spo175890.69Barchart | Table
Spo141720.68Barchart | Table
Spo237330.68Barchart | Table
Spo054670.68Barchart | Table
Spo218280.68Barchart | Table
Spo031920.68Barchart | Table
Spo202420.68Barchart | Table
Spo168820.68Barchart | Table
Spo119930.68Barchart | Table
Spo013970.68Barchart | Table
Spo233550.68Barchart | Table
Spo264820.67Barchart | Table
Spo022540.67Barchart | Table
Spo041600.67Barchart | Table
Spo074150.67Barchart | Table
Spo092190.67Barchart | Table
Spo119190.67Barchart | Table
Spo129400.67Barchart | Table
Spo161610.67Barchart | Table
Spo166890.67Barchart | Table
Spo179140.67Barchart | Table
Spo196650.67Barchart | Table
Spo202440.67Barchart | Table
Spo229700.67Barchart | Table
Spo242320.67Barchart | Table
Spo173400.66Barchart | Table
Spo116800.66Barchart | Table
Spo235070.66Barchart | Table
Spo240660.66Barchart | Table
Spo240890.66Barchart | Table
Spo166870.66Barchart | Table
Spo016630.66Barchart | Table
Spo159970.66Barchart | Table
Spo153620.66Barchart | Table
Spo152700.66Barchart | Table
Spo111900.66Barchart | Table
Spo021150.66Barchart | Table
Spo105500.66Barchart | Table
Spo099580.66Barchart | Table
Spo098420.66Barchart | Table
Spo085410.66Barchart | Table
Spo176780.65Barchart | Table
Spo047030.65Barchart | Table
Spo062490.65Barchart | Table
Spo160880.65Barchart | Table
Spo261900.65Barchart | Table
Spo018010.65Barchart | Table
Spo102510.65Barchart | Table
Spo209090.65Barchart | Table