Spo24623 (gene)

Overview
NameSpo24623
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
Locationchr4 : 105329948 .. 105330427 (-)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGAAAATTCACGATCACAACGCACATCGTCACACGCGCCAGCACGTGAAACACATGCGCCGCGTTACACAGCGCTCGTGACGAACACGCGCTGACTGAAACCACCTTAAAGCAACCAAACCGCACATCCTATTACCTTATTTAACGACTTAACGTCGGTGGTCGAAAATCGAAATCAAAATTAACTAACCTTCCCACTCTGTTCCTCATCTTTTTCACAGCTCACTCTCCCCTGCTTTCTTCCTTCTTTCTCACTCCCTCTATAAATACCTCAAAGATCCTCTCTCCAATTCTCCATTCTTCAATCCACCAAGATCTGTCGGTGCTCAATTTTCCTGGTAATTCTCTCTCCNCCCCCCCCCCCCCCCCCTTGAATTCAGCATTTTTTTTCTTGATTTCCCAATTGCAATTTATCATAGATTTTCCCCAATTATTCACTGATTTTCGGAGATTACCTTACCCAGTTACCCTTCTTTCAGA

mRNA sequence

ATGAAAATTCACGATCACAACGCACATCGTCACACGCGCCAGCACGTGAAACACATGCGCCGCGTTACACAGCGCTCCTCACTCTCCCCTGCTTTCTTCCTTCTTTCTCACTCCCTCTATAAATACCTCAAAGATCCTCTCTCCAATTCTCCATTCTTCAATCCACCAAGATCTGTCGGTGCTCAATTTTCCTGA

Coding sequence (CDS)

ATGAAAATTCACGATCACAACGCACATCGTCACACGCGCCAGCACGTGAAACACATGCGCCGCGTTACACAGCGCTCCTCACTCTCCCCTGCTTTCTTCCTTCTTTCTCACTCCCTCTATAAATACCTCAAAGATCCTCTCTCCAATTCTCCATTCTTCAATCCACCAAGATCTGTCGGTGCTCAATTTTCCTGA

Protein sequence

MKIHDHNAHRHTRQHVKHMRRVTQRSSLSPAFFLLSHSLYKYLKDPLSNSPFFNPPRSVGAQFS
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo24623.1Spo24623.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo24623.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo24623.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo24623.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo24623.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0009657 plastid organization
biological_process GO:0006768 biotin metabolic process
biological_process GO:0006636 unsaturated fatty acid biosynthetic process
biological_process GO:0006364 rRNA processing
biological_process GO:0006771 riboflavin metabolic process
biological_process GO:0010114 response to red light
biological_process GO:0010218 response to far red light
biological_process GO:0009637 response to blue light
biological_process GO:0035304 regulation of protein dephosphorylation
biological_process GO:0010206 photosystem II repair
biological_process GO:0006662 glycerol ether metabolic process
biological_process GO:0010207 photosystem II assembly
biological_process GO:0009773 photosynthetic electron transport in photosystem I
biological_process GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
biological_process GO:0019497 hexachlorocyclohexane metabolic process
biological_process GO:0019344 cysteine biosynthetic process
biological_process GO:0015995 chlorophyll biosynthetic process
biological_process GO:0016117 carotenoid biosynthetic process
biological_process GO:0006979 response to oxidative stress
biological_process GO:0030091 protein repair
biological_process GO:0045454 cell redox homeostasis
biological_process GO:0009414 response to water deprivation
biological_process GO:0022414 reproductive process
biological_process GO:0048481 plant ovule development
biological_process GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway
biological_process GO:0009266 response to temperature stimulus
biological_process GO:0009617 response to bacterium
biological_process GO:0006417 regulation of translation
biological_process GO:0010363 regulation of plant-type hypersensitive response
biological_process GO:0010310 regulation of hydrogen peroxide metabolic process
biological_process GO:0006612 protein targeting to membrane
biological_process GO:0045893 positive regulation of transcription, DNA-templated
biological_process GO:0017148 negative regulation of translation
biological_process GO:0052543 callose deposition in cell wall
biological_process GO:0045892 negative regulation of transcription, DNA-templated
biological_process GO:0009910 negative regulation of flower development
biological_process GO:0031348 negative regulation of defense response
biological_process GO:0009556 microsporogenesis
biological_process GO:0000165 MAPK cascade
biological_process GO:0010076 maintenance of floral meristem identity
biological_process GO:0009965 leaf morphogenesis
biological_process GO:0009867 jasmonic acid mediated signaling pathway
biological_process GO:0010582 floral meristem determinacy
biological_process GO:0006464 cellular protein modification process
biological_process GO:0019761 glucosinolate biosynthetic process
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0006508 proteolysis
biological_process GO:0008152 metabolic process
biological_process GO:0009658 chloroplast organization
biological_process GO:0006457 protein folding
biological_process GO:0043090 amino acid import
biological_process GO:0030007 cellular potassium ion homeostasis
biological_process GO:0000911 cytokinesis by cell plate formation
biological_process GO:0006855 drug transmembrane transport
biological_process GO:0006888 ER to Golgi vesicle-mediated transport
biological_process GO:0000226 microtubule cytoskeleton organization
biological_process GO:0009651 response to salt stress
biological_process GO:0007165 signal transduction
biological_process GO:0042908 xenobiotic transport
biological_process GO:0033043 regulation of organelle organization
biological_process GO:0006621 protein retention in ER lumen
biological_process GO:0009734 auxin-activated signaling pathway
biological_process GO:0009653 anatomical structure morphogenesis
biological_process GO:0006310 DNA recombination
biological_process GO:0006974 cellular response to DNA damage stimulus
biological_process GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation
biological_process GO:0051276 chromosome organization
biological_process GO:0007059 chromosome segregation
biological_process GO:0003006 developmental process involved in reproduction
biological_process GO:0007127 meiosis I
biological_process GO:0007017 microtubule-based process
biological_process GO:0009791 post-embryonic development
biological_process GO:0070647 protein modification by small protein conjugation or removal
biological_process GO:0009086 methionine biosynthetic process
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0009535 chloroplast thylakoid membrane
cellular_component GO:0005634 nucleus
cellular_component GO:0005840 ribosome
cellular_component GO:0005667 transcription factor complex
cellular_component GO:0009506 plasmodesma
cellular_component GO:0005875 microtubule associated complex
cellular_component GO:0009570 chloroplast stroma
cellular_component GO:0000325 plant-type vacuole
cellular_component GO:0009941 chloroplast envelope
cellular_component GO:0009534 chloroplast thylakoid
cellular_component GO:0005886 plasma membrane
cellular_component GO:0005783 endoplasmic reticulum
cellular_component GO:0031977 thylakoid lumen
cellular_component GO:0005774 vacuolar membrane
molecular_function GO:0000900 translation repressor activity, mRNA regulatory element binding
molecular_function GO:0046983 protein dimerization activity
molecular_function GO:0003700 DNA-binding transcription factor activity
molecular_function GO:0003677 DNA binding
molecular_function GO:0046923 ER retention sequence binding
molecular_function GO:0005515 protein binding
molecular_function GO:0003993 acid phosphatase activity
molecular_function GO:0046872 metal ion binding
molecular_function GO:0004077 biotin-[acetyl-CoA-carboxylase] ligase activity
molecular_function GO:0003756 protein disulfide isomerase activity
molecular_function GO:0043621 protein self-association
molecular_function GO:0008113 peptide-methionine (S)-S-oxide reductase activity
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0008559 xenobiotic transmembrane transporting ATPase activity
molecular_function GO:0008281 sulfonylurea receptor activity
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0009055 electron transfer activity
molecular_function GO:0015035 protein disulfide oxidoreductase activity
molecular_function GO:0004252 serine-type endopeptidase activity
RNA-Seq Expression