Spo26672 (gene) | SpinachBase

Overview


Name	Spo26672
Type	gene
Organism	Spinacia oleracea (Spinach)
Description	Unknown protein
Location	SpoScf_04339 : 6626 .. 7531 (-)

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGCAAAGTTGCAAACCAATTCTTGGCTTTTGTTTCGAGTTCACTTCTTTGAAAGTGATGAGACATTATGTAGCAAAATCTCTTTCAAATTGGTGGTTGTGGATTGTAATTGTATCATTCATTTTTTGATATAAATTTTGCATTTTGTGTATAGGTAAAAGTGGATGGAATGAGCATTATATATTCGCTTTCACTACATCAAGCTTTCATTGTCAATGCTTATTTTCTAAATTGTACAGGCTACAAATTCATACTTGTATCTAAATTCATGGAAAATGTAATCAGTAAAAAATTGAGTTAAAATTAACAAAAATAAGTCATCTTCTTCCAATTAAGTTCACTCAATACTACTTCAAACAAAATCAATATGACAATTTCGGGGAGTGCTAGTCACATCTAAATACTTATTTCAATAGCAATTTGGATTATACACCTGATTGTGCATCTCGATGAACATTTATTAAGCAGCTAATGAACATGGAAAAAATTTCAATGTACGTACAAGTGAAACATTAAACTAAACTTCGTGTTCTTTGAAATTTGAATTATATGTTCACTTACTATATATTACTTCTACTGTTCTTTTTTAAATGACACAATTATTTAGGCACGTTTGTCAACGCACGAAATGAAGTCAAATGAGCTTGTGTGAATAGTGTCAAAAATTCAATTGTGTTATGTAAATAATAACGGAGGAAGTATTTGGTTCATTTAAAAAGAGTGGGCAGTTGGGCACTCGGCACTCCTCTGCAACCCGATCCATTCCCAAGCGTGGTGCACCCTTTTTACACCTCTCCCTCGTTATCTCTCCCCCTCTTCCCTAAAACCCAAAACCCAAAACCCAAACTCCCCCCTCCATTAGAAAGCTTGAAAGAACTCAAATTCTGTTTCAATGGCGAAAAATAA

mRNA sequence

ATGCAAAGTTGCAAACCAATTCTTGGCTTTTGTTTCGAGTTCACTTCTTTGAAAGTGATGAGACATTATGTAGCAAAATCTCTTTCAAATTGTTGGGCACTCGGCACTCCTCTGCAACCCGATCCATTCCCAAGCGTGGTGCACCCTTTTTACACCTCTCCCTCGTTATCTCTCCCCCTCTTCCCTAAAACCCAAAACCCAAAACCCAAACTCCCCCCTCCATTAGAAAGCTTGAAAGAACTCAAATTCTGTTTCAATGGCGAAAAATAA

Coding sequence (CDS)

ATGCAAAGTTGCAAACCAATTCTTGGCTTTTGTTTCGAGTTCACTTCTTTGAAAGTGATGAGACATTATGTAGCAAAATCTCTTTCAAATTGTTGGGCACTCGGCACTCCTCTGCAACCCGATCCATTCCCAAGCGTGGTGCACCCTTTTTACACCTCTCCCTCGTTATCTCTCCCCCTCTTCCCTAAAACCCAAAACCCAAAACCCAAACTCCCCCCTCCATTAGAAAGCTTGAAAGAACTCAAATTCTGTTTCAATGGCGAAAAATAA

Protein sequence

MQSCKPILGFCFEFTSLKVMRHYVAKSLSNCWALGTPLQPDPFPSVVHPFYTSPSLSLPLFPKTQNPKPKLPPPLESLKELKFCFNGEK

Relationships

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Type
Spo26672.1	Spo26672.1	mRNA

Homology

The following BLAST results are available for this feature:

BLAST of Spo26672.1 vs. NCBI nr
BLAST of Spo26672.1 vs. UniProtKB/TrEMBL
BLAST of Spo26672.1 vs. ExPASy Swiss-Prot
BLAST of Spo26672.1 vs. TAIR (Arabidopsis)

BLAST of Spo26672.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo26672.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo26672.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo26672.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

GO Annotation

GO Assignments

This gene is annotated with the following GO terms.

Category	Term Accession	Term Name
biological_process	GO:0006468	protein phosphorylation
biological_process	GO:1901576	organic substance biosynthetic process
biological_process	GO:0034654	nucleobase-containing compound biosynthetic process
biological_process	GO:0006260	DNA replication
biological_process	GO:0071897	DNA biosynthetic process
biological_process	GO:0009611	response to wounding
biological_process	GO:0034976	response to endoplasmic reticulum stress
biological_process	GO:0009805	coumarin biosynthetic process
biological_process	GO:0044281	small molecule metabolic process
biological_process	GO:0006796	phosphate-containing compound metabolic process
biological_process	GO:0019637	organophosphate metabolic process
biological_process	GO:0044260	cellular macromolecule metabolic process
biological_process	GO:0031323	regulation of cellular metabolic process
biological_process	GO:0016043	cellular component organization
biological_process	GO:0044262	cellular carbohydrate metabolic process
biological_process	GO:0044249	cellular biosynthetic process
biological_process	GO:1901135	carbohydrate derivative metabolic process
biological_process	GO:0009966	regulation of signal transduction
biological_process	GO:0006614	SRP-dependent cotranslational protein targeting to membrane
biological_process	GO:0009250	glucan biosynthetic process
biological_process	GO:0006434	seryl-tRNA aminoacylation
biological_process	GO:0097056	selenocysteinyl-tRNA(Sec) biosynthetic process
biological_process	GO:0006996	organelle organization
biological_process	GO:0060255	regulation of macromolecule metabolic process
biological_process	GO:0006499	N-terminal protein myristoylation
biological_process	GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
biological_process	GO:0016458	gene silencing
biological_process	GO:0009908	flower development
biological_process	GO:0015979	photosynthesis
biological_process	GO:0045333	cellular respiration
biological_process	GO:0009408	response to heat
biological_process	GO:0009308	amine metabolic process
biological_process	GO:0009862	systemic acquired resistance, salicylic acid mediated signaling pathway
biological_process	GO:0009089	lysine biosynthetic process via diaminopimelate
biological_process	GO:0009693	ethylene biosynthetic process
biological_process	GO:0006887	exocytosis
biological_process	GO:0080090	regulation of primary metabolic process
biological_process	GO:0006400	tRNA modification
biological_process	GO:0008618	7-methylguanosine metabolic process
biological_process	GO:0042779	tRNA 3'-trailer cleavage
biological_process	GO:0006470	protein dephosphorylation
biological_process	GO:0048608	reproductive structure development
biological_process	GO:0022414	reproductive process
biological_process	GO:0009791	post-embryonic development
biological_process	GO:0009790	embryo development
biological_process	GO:0007020	microtubule nucleation
biological_process	GO:0016998	cell wall macromolecule catabolic process
biological_process	GO:0009165	nucleotide biosynthetic process
biological_process	GO:0006855	drug transmembrane transport
biological_process	GO:0044238	primary metabolic process
biological_process	GO:0045454	cell redox homeostasis
biological_process	GO:0006783	heme biosynthetic process
biological_process	GO:0010027	thylakoid membrane organization
biological_process	GO:0016556	mRNA modification
biological_process	GO:0006098	pentose-phosphate shunt
biological_process	GO:0005975	carbohydrate metabolic process
biological_process	GO:0006099	tricarboxylic acid cycle
biological_process	GO:0046685	response to arsenic-containing substance
biological_process	GO:0042744	hydrogen peroxide catabolic process
biological_process	GO:0050787	detoxification of mercury ion
biological_process	GO:0006086	acetyl-CoA biosynthetic process from pyruvate
biological_process	GO:0008654	phospholipid biosynthetic process
biological_process	GO:0015996	chlorophyll catabolic process
biological_process	GO:0045694	regulation of embryo sac egg cell differentiation
biological_process	GO:0000741	karyogamy
biological_process	GO:0055085	transmembrane transport
biological_process	GO:0032259	methylation
biological_process	GO:0006427	histidyl-tRNA aminoacylation
biological_process	GO:0006547	histidine metabolic process
biological_process	GO:0015693	magnesium ion transport
biological_process	GO:0009058	biosynthetic process
biological_process	GO:0016192	vesicle-mediated transport
biological_process	GO:0000023	maltose metabolic process
biological_process	GO:0009657	plastid organization
biological_process	GO:1901671	positive regulation of superoxide dismutase activity
biological_process	GO:0010207	photosystem II assembly
biological_process	GO:0006354	DNA-templated transcription, elongation
biological_process	GO:0006771	riboflavin metabolic process
biological_process	GO:0015824	proline transport
biological_process	GO:0019497	hexachlorocyclohexane metabolic process
biological_process	GO:0016311	dephosphorylation
biological_process	GO:0006412	translation
biological_process	GO:0042254	ribosome biogenesis
biological_process	GO:0009651	response to salt stress
biological_process	GO:0019344	cysteine biosynthetic process
biological_process	GO:0043085	positive regulation of catalytic activity
biological_process	GO:0051301	cell division
biological_process	GO:0043247	telomere maintenance in response to DNA damage
biological_process	GO:0009069	serine family amino acid metabolic process
biological_process	GO:0010332	response to gamma radiation
biological_process	GO:0032204	regulation of telomere maintenance
biological_process	GO:0009086	methionine biosynthetic process
biological_process	GO:0006310	DNA recombination
biological_process	GO:0006487	protein N-linked glycosylation
biological_process	GO:0032774	RNA biosynthetic process
biological_process	GO:0070084	protein initiator methionine removal
biological_process	GO:0048366	leaf development
biological_process	GO:0050794	regulation of cellular process
biological_process	GO:0005982	starch metabolic process
biological_process	GO:0032875	regulation of DNA endoreduplication
biological_process	GO:0008299	isoprenoid biosynthetic process
biological_process	GO:0006432	phenylalanyl-tRNA aminoacylation
biological_process	GO:0000055	ribosomal large subunit export from nucleus
biological_process	GO:0042273	ribosomal large subunit biogenesis
biological_process	GO:0030036	actin cytoskeleton organization
biological_process	GO:0048573	photoperiodism, flowering
biological_process	GO:0046496	nicotinamide nucleotide metabolic process
biological_process	GO:0006511	ubiquitin-dependent protein catabolic process
biological_process	GO:0051510	regulation of unidimensional cell growth
biological_process	GO:0051302	regulation of cell division
biological_process	GO:0006429	leucyl-tRNA aminoacylation
biological_process	GO:0009561	megagametogenesis
biological_process	GO:0007276	gamete generation
biological_process	GO:0019430	removal of superoxide radicals
biological_process	GO:0006437	tyrosyl-tRNA aminoacylation
biological_process	GO:0045892	negative regulation of transcription, DNA-templated
biological_process	GO:0010077	maintenance of inflorescence meristem identity
biological_process	GO:0048444	floral organ morphogenesis
biological_process	GO:0009416	response to light stimulus
biological_process	GO:0048731	system development
biological_process	GO:0042732	D-xylose metabolic process
biological_process	GO:0006450	regulation of translational fidelity
biological_process	GO:0006605	protein targeting
biological_process	GO:0000902	cell morphogenesis
biological_process	GO:0009249	protein lipoylation
biological_process	GO:0009107	lipoate biosynthetic process
biological_process	GO:0071805	potassium ion transmembrane transport
biological_process	GO:0006164	purine nucleotide biosynthetic process
biological_process	GO:0001522	pseudouridine synthesis
biological_process	GO:0032482	Rab protein signal transduction
biological_process	GO:0006623	protein targeting to vacuole
biological_process	GO:0061025	membrane fusion
biological_process	GO:0006888	ER to Golgi vesicle-mediated transport
biological_process	GO:0016049	cell growth
biological_process	GO:0010103	stomatal complex morphogenesis
biological_process	GO:0031347	regulation of defense response
biological_process	GO:0007010	cytoskeleton organization
biological_process	GO:0006812	cation transport
biological_process	GO:0043419	urea catabolic process
biological_process	GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic
biological_process	GO:0042991	obsolete transcription factor import into nucleus
biological_process	GO:0006397	mRNA processing
biological_process	GO:0006402	mRNA catabolic process
biological_process	GO:0000963	mitochondrial RNA processing
biological_process	GO:0000957	mitochondrial RNA catabolic process
biological_process	GO:0050793	regulation of developmental process
biological_process	GO:0070646	protein modification by small protein removal
biological_process	GO:0040029	regulation of gene expression, epigenetic
biological_process	GO:0009435	NAD biosynthetic process
biological_process	GO:0010555	response to mannitol
biological_process	GO:0009749	response to glucose
biological_process	GO:0009750	response to fructose
biological_process	GO:0009723	response to ethylene
biological_process	GO:0009737	response to abscisic acid
biological_process	GO:2000067	regulation of root morphogenesis
biological_process	GO:0007186	G-protein coupled receptor signaling pathway
biological_process	GO:0046686	response to cadmium ion
biological_process	GO:0046497	nicotinate nucleotide metabolic process
biological_process	GO:0055122	response to very low light intensity stimulus
biological_process	GO:0009652	thigmotropism
biological_process	GO:0019530	taurine metabolic process
biological_process	GO:0043157	response to cation stress
biological_process	GO:0060359	response to ammonium ion
biological_process	GO:0048564	photosystem I assembly
biological_process	GO:0009959	negative gravitropism
biological_process	GO:0006259	DNA metabolic process
biological_process	GO:0051276	chromosome organization
biological_process	GO:0010051	xylem and phloem pattern formation
biological_process	GO:0048364	root development
biological_process	GO:0009628	response to abiotic stimulus
biological_process	GO:0009744	response to sucrose
biological_process	GO:0009157	deoxyribonucleoside monophosphate biosynthetic process
biological_process	GO:0070918	production of small RNA involved in gene silencing by RNA
biological_process	GO:0031425	chloroplast RNA processing
biological_process	GO:0035194	posttranscriptional gene silencing by RNA
biological_process	GO:0043414	macromolecule methylation
biological_process	GO:0072594	establishment of protein localization to organelle
biological_process	GO:0003006	developmental process involved in reproduction
biological_process	GO:0051641	cellular localization
biological_process	GO:0030154	cell differentiation
biological_process	GO:0015940	pantothenate biosynthetic process
biological_process	GO:0009451	RNA modification
biological_process	GO:0045727	positive regulation of translation
biological_process	GO:0006449	regulation of translational termination
biological_process	GO:0016310	phosphorylation
biological_process	GO:0043488	regulation of mRNA stability
biological_process	GO:0051083	'de novo' cotranslational protein folding
biological_process	GO:0006694	steroid biosynthetic process
biological_process	GO:0016117	carotenoid biosynthetic process
biological_process	GO:0052889	9,9'-di-cis-zeta-carotene desaturation to 7,9,7',9'-tetra-cis-lycopene
biological_process	GO:0042793	plastid transcription
biological_process	GO:0016226	iron-sulfur cluster assembly
biological_process	GO:0006950	response to stress
biological_process	GO:0034660	ncRNA metabolic process
biological_process	GO:0034968	histone lysine methylation
biological_process	GO:0005985	sucrose metabolic process
biological_process	GO:0000394	RNA splicing, via endonucleolytic cleavage and ligation
biological_process	GO:0010075	regulation of meristem growth
biological_process	GO:0007275	multicellular organism development
biological_process	GO:0001510	RNA methylation
biological_process	GO:0006626	protein targeting to mitochondrion
biological_process	GO:0051604	protein maturation
biological_process	GO:0009616	virus induced gene silencing
biological_process	GO:0006396	RNA processing
biological_process	GO:0016070	RNA metabolic process
biological_process	GO:0015031	protein transport
biological_process	GO:0009607	response to biotic stimulus
biological_process	GO:0016579	protein deubiquitination
biological_process	GO:0000338	protein deneddylation
biological_process	GO:0045893	positive regulation of transcription, DNA-templated
biological_process	GO:0006406	mRNA export from nucleus
biological_process	GO:0010074	maintenance of meristem identity
biological_process	GO:0016571	histone methylation
biological_process	GO:0006897	endocytosis
biological_process	GO:0006952	defense response
biological_process	GO:0051252	regulation of RNA metabolic process
biological_process	GO:0008380	RNA splicing
biological_process	GO:0006563	L-serine metabolic process
biological_process	GO:0009909	regulation of flower development
biological_process	GO:0007346	regulation of mitotic cell cycle
biological_process	GO:0050826	response to freezing
biological_process	GO:0010162	seed dormancy process
biological_process	GO:0009845	seed germination
biological_process	GO:0006566	threonine metabolic process
biological_process	GO:0006560	proline metabolic process
biological_process	GO:0006426	glycyl-tRNA aminoacylation
biological_process	GO:0010048	vernalization response
biological_process	GO:0006544	glycine metabolic process
biological_process	GO:0010182	sugar mediated signaling pathway
biological_process	GO:0006420	arginyl-tRNA aminoacylation
biological_process	GO:0006525	arginine metabolic process
biological_process	GO:0006810	transport
biological_process	GO:0016233	telomere capping
biological_process	GO:0010228	vegetative to reproductive phase transition of meristem
biological_process	GO:0006265	DNA topological change
biological_process	GO:0031047	gene silencing by RNA
biological_process	GO:0042967	obsolete acyl-carrier-protein biosynthetic process
biological_process	GO:0005976	polysaccharide metabolic process
biological_process	GO:0009097	isoleucine biosynthetic process
biological_process	GO:0006096	glycolytic process
biological_process	GO:0031048	chromatin silencing by small RNA
biological_process	GO:0009630	gravitropism
biological_process	GO:0006094	gluconeogenesis
biological_process	GO:0045132	meiotic chromosome segregation
biological_process	GO:0007062	sister chromatid cohesion
biological_process	GO:0006886	intracellular protein transport
biological_process	GO:0055114	oxidation-reduction process
biological_process	GO:0000413	protein peptidyl-prolyl isomerization
biological_process	GO:0006457	protein folding
biological_process	GO:0000398	mRNA splicing, via spliceosome
biological_process	GO:0006661	phosphatidylinositol biosynthetic process
biological_process	GO:0008152	metabolic process
biological_process	GO:0006913	nucleocytoplasmic transport
biological_process	GO:0007264	small GTPase mediated signal transduction
biological_process	GO:0009098	leucine biosynthetic process
biological_process	GO:0009099	valine biosynthetic process
biological_process	GO:0042742	defense response to bacterium
biological_process	GO:0051026	chiasma assembly
biological_process	GO:0009117	nucleotide metabolic process
biological_process	GO:0009409	response to cold
biological_process	GO:0009414	response to water deprivation
biological_process	GO:0010564	regulation of cell cycle process
biological_process	GO:0000278	mitotic cell cycle
biological_process	GO:0042138	meiotic DNA double-strand break formation
biological_process	GO:0032508	DNA duplex unwinding
biological_process	GO:0071702	organic substance transport
biological_process	GO:0009658	chloroplast organization
biological_process	GO:0033036	macromolecule localization
biological_process	GO:0019252	starch biosynthetic process
biological_process	GO:0009627	systemic acquired resistance
biological_process	GO:0006611	protein export from nucleus
biological_process	GO:0010304	PSII associated light-harvesting complex II catabolic process
biological_process	GO:0006508	proteolysis
biological_process	GO:0048481	plant ovule development
biological_process	GO:0006633	fatty acid biosynthetic process
biological_process	GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic
biological_process	GO:0016567	protein ubiquitination
biological_process	GO:0045036	protein targeting to chloroplast
biological_process	GO:0006281	DNA repair
biological_process	GO:0006399	tRNA metabolic process
biological_process	GO:0006777	Mo-molybdopterin cofactor biosynthetic process
biological_process	GO:0006144	purine nucleobase metabolic process
biological_process	GO:0006206	pyrimidine nucleobase metabolic process
biological_process	GO:0006351	transcription, DNA-templated
biological_process	GO:0006364	rRNA processing
biological_process	GO:0009987	cellular process
biological_process	GO:0009102	biotin biosynthetic process
biological_process	GO:0000911	cytokinesis by cell plate formation
biological_process	GO:0000226	microtubule cytoskeleton organization
biological_process	GO:0008033	tRNA processing
biological_process	GO:0009933	meristem structural organization
biological_process	GO:0007267	cell-cell signaling
biological_process	GO:0019288	isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
biological_process	GO:0009220	pyrimidine ribonucleotide biosynthetic process
biological_process	GO:0006306	DNA methylation
biological_process	GO:0006270	DNA replication initiation
biological_process	GO:0051567	histone H3-K9 methylation
biological_process	GO:0051726	regulation of cell cycle
biological_process	GO:0006275	regulation of DNA replication
biological_process	GO:0006606	protein import into nucleus
biological_process	GO:0051321	meiotic cell cycle
biological_process	GO:0019915	lipid storage
biological_process	GO:0010267	production of ta-siRNAs involved in RNA interference
biological_process	GO:0035196	production of miRNAs involved in gene silencing by miRNA
biological_process	GO:0009094	L-phenylalanine biosynthetic process
biological_process	GO:0006486	protein glycosylation
biological_process	GO:0006302	double-strand break repair
biological_process	GO:0008283	cell proliferation
biological_process	GO:0009640	photomorphogenesis
biological_process	GO:0010289	homogalacturonan biosynthetic process
biological_process	GO:0000162	tryptophan biosynthetic process
biological_process	GO:0006571	tyrosine biosynthetic process
biological_process	GO:0090305	nucleic acid phosphodiester bond hydrolysis
biological_process	GO:0009560	embryo sac egg cell differentiation
biological_process	GO:0006312	mitotic recombination
biological_process	GO:0009793	embryo development ending in seed dormancy
cellular_component	GO:0005657	replication fork
cellular_component	GO:0005773	vacuole
cellular_component	GO:0005643	nuclear pore
cellular_component	GO:0042644	chloroplast nucleoid
cellular_component	GO:0019008	molybdopterin synthase complex
cellular_component	GO:0019013	viral nucleocapsid
cellular_component	GO:0009501	amyloplast
cellular_component	GO:0005829	cytosol
cellular_component	GO:0005622	intracellular
cellular_component	GO:0005768	endosome
cellular_component	GO:0000139	Golgi membrane
cellular_component	GO:0005802	trans-Golgi network
cellular_component	GO:0009509	chromoplast
cellular_component	GO:0005794	Golgi apparatus
cellular_component	GO:0034457	Mpp10 complex
cellular_component	GO:0005634	nucleus
cellular_component	GO:0005732	small nucleolar ribonucleoprotein complex
cellular_component	GO:0009507	chloroplast
cellular_component	GO:0009570	chloroplast stroma
cellular_component	GO:0008076	voltage-gated potassium channel complex
cellular_component	GO:0031410	cytoplasmic vesicle
cellular_component	GO:0030532	small nuclear ribonucleoprotein complex
cellular_component	GO:0009941	chloroplast envelope
cellular_component	GO:0005739	mitochondrion
cellular_component	GO:0045254	pyruvate dehydrogenase complex
cellular_component	GO:0031981	nuclear lumen
cellular_component	GO:0009535	chloroplast thylakoid membrane
cellular_component	GO:0016021	integral component of membrane
cellular_component	GO:0009534	chloroplast thylakoid
cellular_component	GO:0045298	tubulin complex
cellular_component	GO:0016020	membrane
cellular_component	GO:0005681	spliceosomal complex
cellular_component	GO:0000781	chromosome, telomeric region
cellular_component	GO:0042575	DNA polymerase complex
cellular_component	GO:0009536	plastid
cellular_component	GO:0009295	nucleoid
cellular_component	GO:0005840	ribosome
cellular_component	GO:0044435	plastid part
cellular_component	GO:0005730	nucleolus
cellular_component	GO:0018444	translation release factor complex
cellular_component	GO:0032040	small-subunit processome
cellular_component	GO:0031965	nuclear membrane
cellular_component	GO:0000785	chromatin
cellular_component	GO:0005786	signal recognition particle, endoplasmic reticulum targeting
cellular_component	GO:0009506	plasmodesma
cellular_component	GO:0009328	phenylalanine-tRNA ligase complex
cellular_component	GO:0009345	glycine-tRNA ligase complex
cellular_component	GO:0048046	apoplast
cellular_component	GO:0005576	extracellular region
cellular_component	GO:0005835	fatty acid synthase complex
cellular_component	GO:1990904	ribonucleoprotein complex
cellular_component	GO:0080008	Cul4-RING E3 ubiquitin ligase complex
cellular_component	GO:0005663	DNA replication factor C complex
cellular_component	GO:0005783	endoplasmic reticulum
cellular_component	GO:0000145	exocyst
cellular_component	GO:0005694	chromosome
cellular_component	GO:0030870	Mre11 complex
cellular_component	GO:0005737	cytoplasm
cellular_component	GO:0005819	spindle
cellular_component	GO:0016607	nuclear speck
cellular_component	GO:0005789	endoplasmic reticulum membrane
cellular_component	GO:0009706	chloroplast inner membrane
cellular_component	GO:0031461	cullin-RING ubiquitin ligase complex
cellular_component	GO:0044425	membrane part
cellular_component	GO:0005886	plasma membrane
molecular_function	GO:0009982	pseudouridine synthase activity
molecular_function	GO:0005524	ATP binding
molecular_function	GO:0004784	superoxide dismutase activity
molecular_function	GO:0019003	GDP binding
molecular_function	GO:0004826	phenylalanine-tRNA ligase activity
molecular_function	GO:0000049	tRNA binding
molecular_function	GO:0008270	zinc ion binding
molecular_function	GO:0004633	phosphopantothenoylcysteine decarboxylase activity
molecular_function	GO:0005488	binding
molecular_function	GO:0004518	nuclease activity
molecular_function	GO:0008408	3'-5' exonuclease activity
molecular_function	GO:0008173	RNA methyltransferase activity
molecular_function	GO:0002161	aminoacyl-tRNA editing activity
molecular_function	GO:0032549	ribonucleoside binding
molecular_function	GO:1901363	heterocyclic compound binding
molecular_function	GO:0016887	ATPase activity
molecular_function	GO:0004674	protein serine/threonine kinase activity
molecular_function	GO:0000175	3'-5'-exoribonuclease activity
molecular_function	GO:0005515	protein binding
molecular_function	GO:0052855	ADP-dependent NAD(P)H-hydrate dehydratase activity
molecular_function	GO:0008017	microtubule binding
molecular_function	GO:0008184	glycogen phosphorylase activity
molecular_function	GO:0042802	identical protein binding
molecular_function	GO:0030170	pyridoxal phosphate binding
molecular_function	GO:0047453	ATP-dependent NAD(P)H-hydrate dehydratase activity
molecular_function	GO:0047631	ADP-ribose diphosphatase activity
molecular_function	GO:0043167	ion binding
molecular_function	GO:0016874	ligase activity
molecular_function	GO:0004654	polyribonucleotide nucleotidyltransferase activity
molecular_function	GO:0047884	FAD diphosphatase activity
molecular_function	GO:0004831	tyrosine-tRNA ligase activity
molecular_function	GO:0031625	ubiquitin protein ligase binding
molecular_function	GO:0016151	nickel cation binding
molecular_function	GO:0004000	adenosine deaminase activity
molecular_function	GO:0005249	voltage-gated potassium channel activity
molecular_function	GO:0004823	leucine-tRNA ligase activity
molecular_function	GO:0031072	heat shock protein binding
molecular_function	GO:0003747	translation release factor activity
molecular_function	GO:0004527	exonuclease activity
molecular_function	GO:0008146	sulfotransferase activity
molecular_function	GO:0003899	DNA-directed 5'-3' RNA polymerase activity
molecular_function	GO:0016740	transferase activity
molecular_function	GO:0003682	chromatin binding
molecular_function	GO:0008568	microtubule-severing ATPase activity
molecular_function	GO:0004048	anthranilate phosphoribosyltransferase activity
molecular_function	GO:0005507	copper ion binding
molecular_function	GO:0008168	methyltransferase activity
molecular_function	GO:0003735	structural constituent of ribosome
molecular_function	GO:0051287	NAD binding
molecular_function	GO:0016746	transferase activity, transferring acyl groups
molecular_function	GO:0004316	3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
molecular_function	GO:0003993	acid phosphatase activity
molecular_function	GO:0016791	phosphatase activity
molecular_function	GO:0004820	glycine-tRNA ligase activity
molecular_function	GO:0019843	rRNA binding
molecular_function	GO:0004814	arginine-tRNA ligase activity
molecular_function	GO:0015297	antiporter activity
molecular_function	GO:0015238	drug transmembrane transporter activity
molecular_function	GO:0004828	serine-tRNA ligase activity
molecular_function	GO:0070006	metalloaminopeptidase activity
molecular_function	GO:0004015	adenosylmethionine-8-amino-7-oxononanoate transaminase activity
molecular_function	GO:0016757	transferase activity, transferring glycosyl groups
molecular_function	GO:0008233	peptidase activity
molecular_function	GO:0047262	polygalacturonate 4-alpha-galacturonosyltransferase activity
molecular_function	GO:0008094	DNA-dependent ATPase activity
molecular_function	GO:0015095	magnesium ion transmembrane transporter activity
molecular_function	GO:0046983	protein dimerization activity
molecular_function	GO:0004821	histidine-tRNA ligase activity
molecular_function	GO:0008757	S-adenosylmethionine-dependent methyltransferase activity
molecular_function	GO:0004672	protein kinase activity
molecular_function	GO:0003958	NADPH-hemoprotein reductase activity
molecular_function	GO:0017111	nucleoside-triphosphatase activity
molecular_function	GO:0051082	unfolded protein binding
molecular_function	GO:0004141	dethiobiotin synthase activity
molecular_function	GO:0010181	FMN binding
molecular_function	GO:0051539	4 iron, 4 sulfur cluster binding
molecular_function	GO:0030366	molybdopterin synthase activity
molecular_function	GO:0004148	dihydrolipoyl dehydrogenase activity
molecular_function	GO:0050660	flavin adenine dinucleotide binding
molecular_function	GO:0016152	mercury (II) reductase activity
molecular_function	GO:0045340	mercury ion binding
molecular_function	GO:0050661	NADP binding
molecular_function	GO:0000287	magnesium ion binding
molecular_function	GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds
molecular_function	GO:0043169	cation binding
molecular_function	GO:0008312	7S RNA binding
molecular_function	GO:0003924	GTPase activity
molecular_function	GO:0019136	deoxynucleoside kinase activity
molecular_function	GO:0046872	metal ion binding
molecular_function	GO:0004176	ATP-dependent peptidase activity
molecular_function	GO:0047800	cysteamine dioxygenase activity
molecular_function	GO:0016810	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
molecular_function	GO:0003952	NAD+ synthase (glutamine-hydrolyzing) activity
molecular_function	GO:0004739	pyruvate dehydrogenase (acetyl-transferring) activity
molecular_function	GO:0031683	G-protein beta/gamma-subunit complex binding
molecular_function	GO:0004871	obsolete signal transducer activity
molecular_function	GO:0003723	RNA binding
molecular_function	GO:0016787	hydrolase activity
molecular_function	GO:0004386	helicase activity
molecular_function	GO:0016773	phosphotransferase activity, alcohol group as acceptor
molecular_function	GO:0003755	peptidyl-prolyl cis-trans isomerase activity
molecular_function	GO:0000166	nucleotide binding
molecular_function	GO:0016301	kinase activity
molecular_function	GO:0004842	ubiquitin-protein transferase activity
molecular_function	GO:0052887	7,9,9'-tricis-neurosporene:quinone oxidoreductase activity
molecular_function	GO:0052886	9,9'-dicis-carotene:quinone oxidoreductase activity
molecular_function	GO:0016719	carotene 7,8-desaturase activity
molecular_function	GO:0016788	hydrolase activity, acting on ester bonds
molecular_function	GO:0005525	GTP binding
molecular_function	GO:0004222	metalloendopeptidase activity
molecular_function	GO:0004519	endonuclease activity
molecular_function	GO:0016491	oxidoreductase activity
molecular_function	GO:0004721	phosphoprotein phosphatase activity
molecular_function	GO:0005506	iron ion binding
molecular_function	GO:0020037	heme binding
molecular_function	GO:0004523	RNA-DNA hybrid ribonuclease activity
molecular_function	GO:0003849	3-deoxy-7-phosphoheptulonate synthase activity
molecular_function	GO:0003887	DNA-directed DNA polymerase activity
molecular_function	GO:0004252	serine-type endopeptidase activity
molecular_function	GO:0070008	serine-type exopeptidase activity
molecular_function	GO:0003689	DNA clamp loader activity
molecular_function	GO:0003824	catalytic activity
molecular_function	GO:0016891	endoribonuclease activity, producing 5'-phosphomonoesters
molecular_function	GO:0008026	ATP-dependent helicase activity
molecular_function	GO:0003917	DNA topoisomerase type I activity
molecular_function	GO:0003677	DNA binding
molecular_function	GO:0019905	syntaxin binding
molecular_function	GO:0010285	L,L-diaminopimelate aminotransferase activity
molecular_function	GO:0003676	nucleic acid binding
molecular_function	GO:0048038	quinone binding
molecular_function	GO:0005516	calmodulin binding
molecular_function	GO:0003678	DNA helicase activity
molecular_function	GO:0005509	calcium ion binding
molecular_function	GO:0016779	nucleotidyltransferase activity
molecular_function	GO:0016992	lipoate synthase activity

RNA-Seq Expression

Co-expression


Gene	r value	Expression
Spo23127	0.82	Barchart \| Table
Spo08879	0.80	Barchart \| Table
Spo18646	0.79	Barchart \| Table
Spo25846	0.79	Barchart \| Table
Spo02221	0.79	Barchart \| Table
Spo03505	0.78	Barchart \| Table
Spo17367	0.78	Barchart \| Table
Spo22543	0.77	Barchart \| Table
Spo27291	0.77	Barchart \| Table
Spo08312	0.77	Barchart \| Table
Spo05208	0.77	Barchart \| Table
Spo17547	0.77	Barchart \| Table
Spo01201	0.77	Barchart \| Table
Spo03609	0.77	Barchart \| Table
Spo13238	0.77	Barchart \| Table
Spo22525	0.76	Barchart \| Table
Spo24841	0.76	Barchart \| Table
Spo00391	0.76	Barchart \| Table
Spo18296	0.76	Barchart \| Table
Spo16394	0.76	Barchart \| Table
Spo08968	0.76	Barchart \| Table
Spo06791	0.75	Barchart \| Table
Spo00554	0.75	Barchart \| Table
Spo13318	0.75	Barchart \| Table
Spo24153	0.75	Barchart \| Table
Spo25615	0.75	Barchart \| Table
Spo04988	0.75	Barchart \| Table
Spo08106	0.75	Barchart \| Table
Spo21646	0.74	Barchart \| Table
Spo06137	0.74	Barchart \| Table
Spo03057	0.74	Barchart \| Table
Spo15481	0.74	Barchart \| Table
Spo22566	0.74	Barchart \| Table
Spo23898	0.74	Barchart \| Table
Spo17490	0.74	Barchart \| Table
Spo15401	0.74	Barchart \| Table
Spo04104	0.74	Barchart \| Table
Spo22053	0.74	Barchart \| Table
Spo08533	0.73	Barchart \| Table
Spo13492	0.73	Barchart \| Table
Spo00178	0.73	Barchart \| Table
Spo01970	0.73	Barchart \| Table
Spo24787	0.73	Barchart \| Table
Spo20889	0.73	Barchart \| Table
Spo16563	0.73	Barchart \| Table
Spo22475	0.73	Barchart \| Table
Spo03627	0.73	Barchart \| Table
Spo03835	0.73	Barchart \| Table
Spo09562	0.73	Barchart \| Table
Spo26978	0.73	Barchart \| Table
Spo06522	0.73	Barchart \| Table
Spo02242	0.73	Barchart \| Table
Spo21501	0.73	Barchart \| Table
Spo17081	0.72	Barchart \| Table
Spo05318	0.72	Barchart \| Table
Spo21865	0.72	Barchart \| Table
Spo01828	0.72	Barchart \| Table
Spo06789	0.72	Barchart \| Table
Spo15482	0.72	Barchart \| Table
Spo02579	0.72	Barchart \| Table
Spo13708	0.72	Barchart \| Table
Spo01713	0.72	Barchart \| Table
Spo12143	0.72	Barchart \| Table
Spo20914	0.72	Barchart \| Table
Spo01831	0.72	Barchart \| Table
Spo04453	0.72	Barchart \| Table
Spo27239	0.72	Barchart \| Table
Spo02271	0.72	Barchart \| Table
Spo22666	0.72	Barchart \| Table
Spo06646	0.72	Barchart \| Table
Spo14983	0.72	Barchart \| Table
Spo26214	0.72	Barchart \| Table
Spo01997	0.72	Barchart \| Table
Spo10702	0.71	Barchart \| Table
Spo00161	0.71	Barchart \| Table
Spo03027	0.71	Barchart \| Table
Spo26235	0.71	Barchart \| Table
Spo03299	0.71	Barchart \| Table
Spo04682	0.71	Barchart \| Table
Spo05879	0.71	Barchart \| Table
Spo25874	0.71	Barchart \| Table
Spo06287	0.71	Barchart \| Table
Spo00670	0.71	Barchart \| Table
Spo00155	0.71	Barchart \| Table
Spo25234	0.71	Barchart \| Table
Spo10585	0.71	Barchart \| Table
Spo18479	0.71	Barchart \| Table
Spo10827	0.71	Barchart \| Table
Spo24871	0.71	Barchart \| Table
Spo11882	0.71	Barchart \| Table
Spo12921	0.71	Barchart \| Table
Spo13389	0.71	Barchart \| Table
Spo14833	0.71	Barchart \| Table
Spo14995	0.71	Barchart \| Table
Spo15025	0.71	Barchart \| Table
Spo17235	0.71	Barchart \| Table
Spo17291	0.71	Barchart \| Table
Spo08219	0.70	Barchart \| Table
Spo26068	0.70	Barchart \| Table
Spo08564	0.70	Barchart \| Table
Spo05076	0.70	Barchart \| Table
Spo25694	0.70	Barchart \| Table
Spo09493	0.70	Barchart \| Table
Spo24939	0.70	Barchart \| Table
Spo10661	0.70	Barchart \| Table
Spo03077	0.70	Barchart \| Table
Spo03076	0.70	Barchart \| Table
Spo12023	0.70	Barchart \| Table
Spo02855	0.70	Barchart \| Table
Spo00263	0.70	Barchart \| Table
Spo13374	0.70	Barchart \| Table
Spo02499	0.70	Barchart \| Table
Spo23932	0.70	Barchart \| Table
Spo26727	0.70	Barchart \| Table
Spo14013	0.70	Barchart \| Table
Spo23889	0.70	Barchart \| Table
Spo18276	0.70	Barchart \| Table
Spo23698	0.70	Barchart \| Table
Spo21619	0.70	Barchart \| Table
Spo23668	0.70	Barchart \| Table
Spo21419	0.70	Barchart \| Table
Spo16794	0.70	Barchart \| Table
Spo23320	0.70	Barchart \| Table
Spo20749	0.70	Barchart \| Table
Spo18446	0.70	Barchart \| Table
Spo25851	0.70	Barchart \| Table
Spo05968	0.70	Barchart \| Table
Spo00501	0.70	Barchart \| Table
Spo07623	0.70	Barchart \| Table
Spo08105	0.70	Barchart \| Table
Spo22458	0.69	Barchart \| Table
Spo17889	0.69	Barchart \| Table
Spo26452	0.69	Barchart \| Table
Spo13245	0.69	Barchart \| Table
Spo23380	0.69	Barchart \| Table
Spo07079	0.69	Barchart \| Table
Spo19499	0.69	Barchart \| Table
Spo14310	0.69	Barchart \| Table
Spo02440	0.69	Barchart \| Table
Spo14403	0.69	Barchart \| Table
Spo14408	0.69	Barchart \| Table
Spo14857	0.69	Barchart \| Table
Spo27104	0.69	Barchart \| Table
Spo06455	0.69	Barchart \| Table
Spo25949	0.69	Barchart \| Table
Spo27231	0.69	Barchart \| Table
Spo05359	0.69	Barchart \| Table
Spo08680	0.69	Barchart \| Table
Spo08849	0.69	Barchart \| Table
Spo05640	0.69	Barchart \| Table
Spo04279	0.69	Barchart \| Table
Spo03914	0.69	Barchart \| Table
Spo00579	0.69	Barchart \| Table
Spo03846	0.69	Barchart \| Table
Spo25322	0.69	Barchart \| Table
Spo01612	0.69	Barchart \| Table
Spo19776	0.69	Barchart \| Table
Spo22326	0.69	Barchart \| Table
Spo19519	0.69	Barchart \| Table
Spo17491	0.69	Barchart \| Table
Spo11015	0.69	Barchart \| Table
Spo01615	0.69	Barchart \| Table
Spo16568	0.69	Barchart \| Table
Spo24533	0.68	Barchart \| Table
Spo18480	0.68	Barchart \| Table
Spo00407	0.68	Barchart \| Table
Spo17288	0.68	Barchart \| Table
Spo23955	0.68	Barchart \| Table
Spo00137	0.68	Barchart \| Table
Spo02214	0.68	Barchart \| Table
Spo23933	0.68	Barchart \| Table
Spo20806	0.68	Barchart \| Table
Spo21531	0.68	Barchart \| Table
Spo25344	0.68	Barchart \| Table
Spo22345	0.68	Barchart \| Table
Spo16106	0.68	Barchart \| Table
Spo09940	0.68	Barchart \| Table
Spo23165	0.68	Barchart \| Table
Spo07114	0.68	Barchart \| Table
Spo17085	0.68	Barchart \| Table
Spo13835	0.68	Barchart \| Table
Spo07353	0.68	Barchart \| Table
Spo01313	0.68	Barchart \| Table
Spo27203	0.68	Barchart \| Table
Spo19506	0.68	Barchart \| Table
Spo17305	0.68	Barchart \| Table
Spo05709	0.68	Barchart \| Table
Spo06591	0.68	Barchart \| Table
Spo23536	0.68	Barchart \| Table
Spo00129	0.68	Barchart \| Table
Spo19271	0.68	Barchart \| Table
Spo19007	0.68	Barchart \| Table
Spo03884	0.68	Barchart \| Table
Spo15134	0.68	Barchart \| Table
Spo22005	0.68	Barchart \| Table
Spo23866	0.68	Barchart \| Table
Spo21648	0.68	Barchart \| Table
Spo21910	0.67	Barchart \| Table
Spo00370	0.67	Barchart \| Table
Spo00812	0.67	Barchart \| Table
Spo02648	0.67	Barchart \| Table
Spo02747	0.67	Barchart \| Table
Spo02816	0.67	Barchart \| Table
Spo03002	0.67	Barchart \| Table
Spo03059	0.67	Barchart \| Table
Spo03068	0.67	Barchart \| Table
Spo05733	0.67	Barchart \| Table
Spo06344	0.67	Barchart \| Table
Spo06802	0.67	Barchart \| Table
Spo07071	0.67	Barchart \| Table
Spo07921	0.67	Barchart \| Table
Spo08147	0.67	Barchart \| Table
Spo08335	0.67	Barchart \| Table
Spo08416	0.67	Barchart \| Table
Spo09027	0.67	Barchart \| Table
Spo10100	0.67	Barchart \| Table
Spo10138	0.67	Barchart \| Table
Spo10233	0.67	Barchart \| Table
Spo11180	0.67	Barchart \| Table
Spo12217	0.67	Barchart \| Table
Spo15117	0.67	Barchart \| Table
Spo15431	0.67	Barchart \| Table
Spo16314	0.67	Barchart \| Table
Spo16421	0.67	Barchart \| Table
Spo16804	0.67	Barchart \| Table
Spo19840	0.67	Barchart \| Table
Spo20772	0.67	Barchart \| Table
Spo21474	0.67	Barchart \| Table
Spo21722	0.67	Barchart \| Table
Spo21939	0.67	Barchart \| Table
Spo22654	0.67	Barchart \| Table
Spo23580	0.67	Barchart \| Table
Spo25519	0.67	Barchart \| Table
Spo25738	0.67	Barchart \| Table
Spo26195	0.67	Barchart \| Table
Spo27115	0.67	Barchart \| Table
Spo27144	0.67	Barchart \| Table
Spo28070	0.67	Barchart \| Table
Spo18478	0.66	Barchart \| Table
Spo12111	0.66	Barchart \| Table
Spo11989	0.66	Barchart \| Table
Spo24590	0.66	Barchart \| Table
Spo24597	0.66	Barchart \| Table
Spo24786	0.66	Barchart \| Table
Spo11588	0.66	Barchart \| Table
Spo11069	0.66	Barchart \| Table
Spo10624	0.66	Barchart \| Table
Spo09801	0.66	Barchart \| Table
Spo09028	0.66	Barchart \| Table
Spo06755	0.66	Barchart \| Table
Spo05897	0.66	Barchart \| Table
Spo05529	0.66	Barchart \| Table
Spo01180	0.66	Barchart \| Table
Spo03304	0.66	Barchart \| Table
Spo03195	0.66	Barchart \| Table
Spo02828	0.66	Barchart \| Table
Spo02483	0.66	Barchart \| Table
Spo26736	0.66	Barchart \| Table
Spo26814	0.66	Barchart \| Table
Spo26979	0.66	Barchart \| Table
Spo20941	0.66	Barchart \| Table
Spo18980	0.66	Barchart \| Table
Spo18904	0.66	Barchart \| Table
Spo22940	0.66	Barchart \| Table
Spo17755	0.66	Barchart \| Table
Spo16884	0.66	Barchart \| Table
Spo16844	0.66	Barchart \| Table
Spo23355	0.66	Barchart \| Table
Spo16831	0.66	Barchart \| Table
Spo23459	0.66	Barchart \| Table
Spo23504	0.66	Barchart \| Table
Spo16206	0.66	Barchart \| Table
Spo16201	0.66	Barchart \| Table
Spo15480	0.66	Barchart \| Table
Spo15407	0.66	Barchart \| Table
Spo14781	0.66	Barchart \| Table
Spo14351	0.66	Barchart \| Table
Spo13509	0.66	Barchart \| Table
Spo12725	0.66	Barchart \| Table
Spo01801	0.65	Barchart \| Table
Spo18160	0.65	Barchart \| Table
Spo22869	0.65	Barchart \| Table
Spo24223	0.65	Barchart \| Table
Spo11756	0.65	Barchart \| Table
Spo06606	0.65	Barchart \| Table
Spo18393	0.65	Barchart \| Table
Spo24679	0.65	Barchart \| Table
Spo26803	0.65	Barchart \| Table
Spo05510	0.65	Barchart \| Table
Spo11384	0.65	Barchart \| Table
Spo20894	0.65	Barchart \| Table
Spo01168	0.65	Barchart \| Table
Spo02001	0.65	Barchart \| Table
Spo10484	0.65	Barchart \| Table
Spo23767	0.65	Barchart \| Table
Spo19500	0.65	Barchart \| Table
Spo09582	0.65	Barchart \| Table
Spo00849	0.65	Barchart \| Table
Spo09062	0.65	Barchart \| Table
Spo21833	0.65	Barchart \| Table
Spo01606	0.65	Barchart \| Table
Spo24047	0.65	Barchart \| Table
Spo21421	0.65	Barchart \| Table