Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTGGCAAGGGCAGAAAGTGGCGGAACAATGGATGCAAATTTTTCTGCTAGTTTCAGCAGCTGTGGCATTTGTGACAGGTTATGTGATTGGTTCATTCCAGTTGATGGTTCTGATCTATGCTGGCGGCGTCGTTTTGACTGCTCTGATCATCATCCCAAATTGGCCATGGTACAATCGTCATCCTCTCAATTGGCTTGATTCTAGTGAAGCTGATAAACACCCTAAACCTCAACCTGTTGTTAATTCTGGAAATAAGAAGAAAAACAACAAGCAAAAGTAG ATGGATTGGCAAGGGCAGAAAGTGGCGGAACAATGGATGCAAATTTTTCTGCTAGTTTCAGCAGCTGTGGCATTTGTGACAGGTTATGTGATTGGTTCATTCCAGTTGATGGTTCTGATCTATGCTGGCGGCGTCGTTTTGACTGCTCTGATCATCATCCCAAATTGGCCATGGTACAATCGTCATCCTCTCAATTGGCTTGATTCTAGTGAAGCTGATAAACACCCTAAACCTCAACCTGTTGTTAATTCTGGAAATAAGAAGAAAAACAACAAGCAAAAGTAG ATGGATTGGCAAGGGCAGAAAGTGGCGGAACAATGGATGCAAATTTTTCTGCTAGTTTCAGCAGCTGTGGCATTTGTGACAGGTTATGTGATTGGTTCATTCCAGTTGATGGTTCTGATCTATGCTGGCGGCGTCGTTTTGACTGCTCTGATCATCATCCCAAATTGGCCATGGTACAATCGTCATCCTCTCAATTGGCTTGATTCTAGTGAAGCTGATAAACACCCTAAACCTCAACCTGTTGTTAATTCTGGAAATAAGAAGAAAAACAACAAGCAAAAGTAG MDWQGQKVAEQWMQIFLLVSAAVAFVTGYVIGSFQLMVLIYAGGVVLTALIIIPNWPWYNRHPLNWLDSSEADKHPKPQPVVNSGNKKKNNKQK Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Homology
BLAST of Spo04997.1 vs. NCBI nr
Match: gi|902237164|gb|KNA24674.1| (hypothetical protein SOVF_013600 [Spinacia oleracea]) HSP 1 Score: 190.7 bits (483), Expect = 1.200e-45 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 1
BLAST of Spo04997.1 vs. NCBI nr
Match: gi|731343238|ref|XP_010682793.1| (PREDICTED: probable signal peptidase complex subunit 1 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 170.6 bits (431), Expect = 1.300e-39 Identity = 81/94 (86.17%), Postives = 88/94 (93.62%), Query Frame = 1
BLAST of Spo04997.1 vs. NCBI nr
Match: gi|224107617|ref|XP_002314538.1| (microsomal signal peptidase 12 kDa subunit family protein [Populus trichocarpa]) HSP 1 Score: 136.7 bits (343), Expect = 2.000e-29 Identity = 65/93 (69.89%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of Spo04997.1 vs. NCBI nr
Match: gi|566189497|ref|XP_006378290.1| (hypothetical protein POPTR_0010s06920g [Populus trichocarpa]) HSP 1 Score: 136.7 bits (343), Expect = 2.000e-29 Identity = 65/93 (69.89%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of Spo04997.1 vs. NCBI nr
Match: gi|590692442|ref|XP_007044056.1| (Microsomal signal peptidase 12 kDa subunit (SPC12) [Theobroma cacao]) HSP 1 Score: 135.2 bits (339), Expect = 6.000e-29 Identity = 67/93 (72.04%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of Spo04997.1 vs. UniProtKB/TrEMBL
Match: A0A0K9S0H2_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_013600 PE=4 SV=1) HSP 1 Score: 190.7 bits (483), Expect = 8.300e-46 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 1
BLAST of Spo04997.1 vs. UniProtKB/TrEMBL
Match: A0A0J8EW78_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_6g150980 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 8.900e-40 Identity = 81/94 (86.17%), Postives = 88/94 (93.62%), Query Frame = 1
BLAST of Spo04997.1 vs. UniProtKB/TrEMBL
Match: U5G3S5_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0010s06920g PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.400e-29 Identity = 65/93 (69.89%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of Spo04997.1 vs. UniProtKB/TrEMBL
Match: B9HT84_POPTR (Microsomal signal peptidase 12 kDa subunit family protein OS=Populus trichocarpa GN=POPTR_0010s06920g PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.400e-29 Identity = 65/93 (69.89%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of Spo04997.1 vs. UniProtKB/TrEMBL
Match: A0A061E5H7_THECC (Microsomal signal peptidase 12 kDa subunit (SPC12) OS=Theobroma cacao GN=TCM_008867 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 4.100e-29 Identity = 67/93 (72.04%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of Spo04997.1 vs. ExPASy Swiss-Prot
Match: SPCS1_ARATH (Probable signal peptidase complex subunit 1 OS=Arabidopsis thaliana GN=At2g22425 PE=2 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.800e-26 Identity = 59/93 (63.44%), Postives = 73/93 (78.49%), Query Frame = 1
BLAST of Spo04997.1 vs. ExPASy Swiss-Prot
Match: SPCS1_PIG (Signal peptidase complex subunit 1 OS=Sus scrofa GN=SPCS1 PE=3 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.500e-11 Identity = 37/79 (46.84%), Postives = 45/79 (56.96%), Query Frame = 1
BLAST of Spo04997.1 vs. ExPASy Swiss-Prot
Match: SPCS1_BOVIN (Signal peptidase complex subunit 1 OS=Bos taurus GN=SPCS1 PE=3 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.500e-11 Identity = 38/84 (45.24%), Postives = 48/84 (57.14%), Query Frame = 1
BLAST of Spo04997.1 vs. ExPASy Swiss-Prot
Match: SPCS1_HUMAN (Signal peptidase complex subunit 1 OS=Homo sapiens GN=SPCS1 PE=1 SV=4) HSP 1 Score: 68.9 bits (167), Expect = 3.300e-11 Identity = 37/79 (46.84%), Postives = 46/79 (58.23%), Query Frame = 1
BLAST of Spo04997.1 vs. ExPASy Swiss-Prot
Match: SPCS1_PONAB (Signal peptidase complex subunit 1 OS=Pongo abelii GN=SPCS1 PE=3 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.300e-11 Identity = 37/79 (46.84%), Postives = 46/79 (58.23%), Query Frame = 1
BLAST of Spo04997.1 vs. TAIR (Arabidopsis)
Match: AT4G40042.1 (Microsomal signal peptidase 12 kDa subunit (SPC12)) HSP 1 Score: 127.5 bits (319), Expect = 4.400e-30 Identity = 63/93 (67.74%), Postives = 75/93 (80.65%), Query Frame = 1
BLAST of Spo04997.1 vs. TAIR (Arabidopsis)
Match: AT2G22425.1 (Microsomal signal peptidase 12 kDa subunit (SPC12)) HSP 1 Score: 119.0 bits (297), Expect = 1.600e-27 Identity = 59/93 (63.44%), Postives = 73/93 (78.49%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo04997.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5 Position : 0 Zoom : x 1
BLAST of Spo04997.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5 Position : 0 Zoom : x 1
BLAST of Spo04997.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5 Position : 0 Zoom : x 1
BLAST of Spo04997.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 2 Position : 0 Zoom : x 1
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29 Position : 0 Zoom : x 1
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|