Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGCAGAATCTATTACAAGCACTGAATGTGAGAGTAGAAGGGACGGGTGAGAAGTACCTGGTGTTAGCCCATGGGTTTGGAACTGACCAATCAGCATGGCAAAGAATCCTACCTTATTTTACTCCGTACTACCGTGTCATACTCTATGACTTGGCCTGTGCTGGGAGTGTCAACCCTGACTTCTTCGACTTCCATCGATACACCACCCTCGACGCCTACGTCGACGACCTCCTCGACATCCTCGACGCGCTCGCTGTCACGCGTTGCGCGTATGTTGGCCATTCTGTTTCAGCTATGATCGGCCTTCTTGCTTCTATACGTCGTCGTGATCTTTTCTCTAAGCAAATACTTGTTGGTGCTTCTCCT ATGGGGCAGAATCTATTACAAGCACTGAATGTGAGAGTAGAAGGGACGGGTGAGAAGTACCTGGTGTTAGCCCATGGGTTTGGAACTGACCAATCAGCATGGCAAAGAATCCTACCTTATTTTACTCCGTACTACCGTGTCATACTCTATGACTTGGCCTGTGCTGGGAGTGTCAACCCTGACTTCTTCGACTTCCATCGATACACCACCCTCGACGCCTACGTCGACGACCTCCTCGACATCCTCGACGCGCTCGCTGTCACGCGTTGCGCGTATGTTGGCCATTCTGTTTCAGCTATGATCGGCCTTCTTGCTTCTATACGTCGTCGTGATCTTTTCTCTAAGCAAATACTTGTTGGTGCTTCTCCT ATGGGGCAGAATCTATTACAAGCACTGAATGTGAGAGTAGAAGGGACGGGTGAGAAGTACCTGGTGTTAGCCCATGGGTTTGGAACTGACCAATCAGCATGGCAAAGAATCCTACCTTATTTTACTCCGTACTACCGTGTCATACTCTATGACTTGGCCTGTGCTGGGAGTGTCAACCCTGACTTCTTCGACTTCCATCGATACACCACCCTCGACGCCTACGTCGACGACCTCCTCGACATCCTCGACGCGCTCGCTGTCACGCGTTGCGCGTATGTTGGCCATTCTGTTTCAGCTATGATCGGCCTTCTTGCTTCTATACGTCGTCGTGATCTTTTCTCTAAGCAAATACTTGTTGGTGCTTCTCCT MGQNLLQALNVRVEGTGEKYLVLAHGFGTDQSAWQRILPYFTPYYRVILYDLACAGSVNPDFFDFHRYTTLDAYVDDLLDILDALAVTRCAYVGHSVSAMIGLLASIRRRDLFSKQILVGASP Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Homology
BLAST of Spo08874.1 vs. NCBI nr
Match: gi|902214245|gb|KNA17451.1| (hypothetical protein SOVF_079820 [Spinacia oleracea]) HSP 1 Score: 251.9 bits (642), Expect = 5.700e-64 Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 1
BLAST of Spo08874.1 vs. NCBI nr
Match: gi|731314724|ref|XP_010688104.1| (PREDICTED: probable strigolactone esterase DAD2 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 240.7 bits (613), Expect = 1.300e-60 Identity = 117/123 (95.12%), Postives = 119/123 (96.75%), Query Frame = 1
BLAST of Spo08874.1 vs. NCBI nr
Match: gi|590597067|ref|XP_007018509.1| (Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]) HSP 1 Score: 216.9 bits (551), Expect = 2.000e-53 Identity = 103/123 (83.74%), Postives = 114/123 (92.68%), Query Frame = 1
BLAST of Spo08874.1 vs. NCBI nr
Match: gi|950995456|ref|XP_014505398.1| (PREDICTED: probable strigolactone esterase DAD2 [Vigna radiata var. radiata]) HSP 1 Score: 213.0 bits (541), Expect = 2.900e-52 Identity = 101/123 (82.11%), Postives = 112/123 (91.06%), Query Frame = 1
BLAST of Spo08874.1 vs. NCBI nr
Match: gi|920705721|gb|KOM48946.1| (hypothetical protein LR48_Vigan07g265000 [Vigna angularis]) HSP 1 Score: 213.0 bits (541), Expect = 2.900e-52 Identity = 101/123 (82.11%), Postives = 112/123 (91.06%), Query Frame = 1
BLAST of Spo08874.1 vs. UniProtKB/TrEMBL
Match: A0A0K9RD40_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_079820 PE=4 SV=1) HSP 1 Score: 251.9 bits (642), Expect = 4.000e-64 Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 1
BLAST of Spo08874.1 vs. UniProtKB/TrEMBL
Match: A0A0J8D481_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_1g015160 PE=4 SV=1) HSP 1 Score: 240.7 bits (613), Expect = 9.200e-61 Identity = 117/123 (95.12%), Postives = 119/123 (96.75%), Query Frame = 1
BLAST of Spo08874.1 vs. UniProtKB/TrEMBL
Match: A0A061FMM2_THECC (Alpha/beta-Hydrolases superfamily protein OS=Theobroma cacao GN=TCM_034711 PE=4 SV=1) HSP 1 Score: 216.9 bits (551), Expect = 1.400e-53 Identity = 103/123 (83.74%), Postives = 114/123 (92.68%), Query Frame = 1
BLAST of Spo08874.1 vs. UniProtKB/TrEMBL
Match: A0A0L9V1Y9_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan07g265000 PE=4 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 2.000e-52 Identity = 101/123 (82.11%), Postives = 112/123 (91.06%), Query Frame = 1
BLAST of Spo08874.1 vs. UniProtKB/TrEMBL
Match: A0A0S3RQ85_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.03G263100 PE=4 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 2.000e-52 Identity = 101/123 (82.11%), Postives = 112/123 (91.06%), Query Frame = 1
BLAST of Spo08874.1 vs. ExPASy Swiss-Prot
Match: DAD2_PETHY (Probable strigolactone esterase DAD2 OS=Petunia hybrida GN=DAD2 PE=1 SV=1) HSP 1 Score: 201.1 bits (510), Expect = 7.200e-51 Identity = 98/123 (79.67%), Postives = 106/123 (86.18%), Query Frame = 1
BLAST of Spo08874.1 vs. ExPASy Swiss-Prot
Match: D14_ARATH (Strigolactone esterase D14 OS=Arabidopsis thaliana GN=D14 PE=1 SV=1) HSP 1 Score: 193.4 bits (490), Expect = 1.500e-48 Identity = 90/120 (75.00%), Postives = 105/120 (87.50%), Query Frame = 1
BLAST of Spo08874.1 vs. ExPASy Swiss-Prot
Match: D14_ORYSJ (Strigolactone esterase D14 OS=Oryza sativa subsp. japonica GN=D14 PE=1 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 2.200e-47 Identity = 90/122 (73.77%), Postives = 103/122 (84.43%), Query Frame = 1
BLAST of Spo08874.1 vs. ExPASy Swiss-Prot
Match: KAI2_ARATH (Probable esterase KAI2 OS=Arabidopsis thaliana GN=KAI2 PE=1 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 5.200e-33 Identity = 65/117 (55.56%), Postives = 87/117 (74.36%), Query Frame = 1
BLAST of Spo08874.1 vs. ExPASy Swiss-Prot
Match: D14L_ORYSJ (Probable esterase D14L OS=Oryza sativa subsp. japonica GN=D14L PE=2 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 3.400e-32 Identity = 68/118 (57.63%), Postives = 85/118 (72.03%), Query Frame = 1
BLAST of Spo08874.1 vs. TAIR (Arabidopsis)
Match: AT3G03990.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 193.4 bits (490), Expect = 8.500e-50 Identity = 90/120 (75.00%), Postives = 105/120 (87.50%), Query Frame = 1
BLAST of Spo08874.1 vs. TAIR (Arabidopsis)
Match: AT4G37470.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 141.7 bits (356), Expect = 2.900e-34 Identity = 65/117 (55.56%), Postives = 87/117 (74.36%), Query Frame = 1
BLAST of Spo08874.1 vs. TAIR (Arabidopsis)
Match: AT3G24420.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 107.5 bits (267), Expect = 6.100e-24 Identity = 48/120 (40.00%), Postives = 81/120 (67.50%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo08874.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5 Position : 0 Zoom : x 1
BLAST of Spo08874.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5 Position : 0 Zoom : x 1
BLAST of Spo08874.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5 Position : 0 Zoom : x 1
BLAST of Spo08874.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 3 Position : 0 Zoom : x 1
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29 Position : 0 Zoom : x 1
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|