Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.GGACTTAAGAATTACAAGGAGTATAAGGAGGCTGTCGAGTCACGAATTGCTCTTGGACGTATTGGGAACTCGGATGAAATTTCAGCTGTAGTTGCGTTTTTATGTCTACCAGCAGCTTCTTATATAACTGGACAAACTATAACCGTCGATGGAGGTTTTACTATTAATGCCTTCATACCACTTCCGCTTAATGAGAAGGCCAAGGAAAATAATTGA GGACTTAAGAATTACAAGGAGTATAAGGAGGCTGTCGAGTCACGAATTGCTCTTGGACGTATTGGGAACTCGGATGAAATTTCAGCTGTAGTTGCGTTTTTATGTCTACCAGCAGCTTCTTATATAACTGGACAAACTATAACCGTCGATGGAGGTTTTACTATTAATGCCTTCATACCACTTCCGCTTAATGAGAAGGCCAAGGAAAATAATTGA GGACTTAAGAATTACAAGGAGTATAAGGAGGCTGTCGAGTCACGAATTGCTCTTGGACGTATTGGGAACTCGGATGAAATTTCAGCTGTAGTTGCGTTTTTATGTCTACCAGCAGCTTCTTATATAACTGGACAAACTATAACCGTCGATGGAGGTTTTACTATTAATGCCTTCATACCACTTCCGCTTAATGAGAAGGCCAAGGAAAATAATTGA GLKNYKEYKEAVESRIALGRIGNSDEISAVVAFLCLPAASYITGQTITVDGGFTINAFIPLPLNEKAKENN Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Homology
BLAST of Spo10180.1 vs. NCBI nr
Match: gi|902239283|gb|KNA25545.1| (hypothetical protein SOVF_004770 [Spinacia oleracea]) HSP 1 Score: 142.9 bits (359), Expect = 2.200e-31 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Spo10180.1 vs. NCBI nr
Match: gi|379319201|gb|AFC98466.1| (short chain alcohol dehydrogenase-like protein [Atriplex canescens]) HSP 1 Score: 103.6 bits (257), Expect = 1.400e-19 Identity = 48/69 (69.57%), Postives = 61/69 (88.41%), Query Frame = 1
BLAST of Spo10180.1 vs. NCBI nr
Match: gi|870861453|gb|KMT12725.1| (hypothetical protein BVRB_4g088210 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 99.0 bits (245), Expect = 3.600e-18 Identity = 45/64 (70.31%), Postives = 56/64 (87.50%), Query Frame = 1
BLAST of Spo10180.1 vs. NCBI nr
Match: gi|731329641|ref|XP_010675702.1| (PREDICTED: tropinone reductase homolog At1g07440-like isoform X2 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 94.4 bits (233), Expect = 8.800e-17 Identity = 43/62 (69.35%), Postives = 54/62 (87.10%), Query Frame = 1
BLAST of Spo10180.1 vs. NCBI nr
Match: gi|731329639|ref|XP_010675701.1| (PREDICTED: tropinone reductase homolog At1g07440-like isoform X1 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 94.4 bits (233), Expect = 8.800e-17 Identity = 43/62 (69.35%), Postives = 54/62 (87.10%), Query Frame = 1
BLAST of Spo10180.1 vs. UniProtKB/TrEMBL
Match: A0A0K9S1C2_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_004770 PE=4 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 1.500e-31 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Spo10180.1 vs. UniProtKB/TrEMBL
Match: H9B3S1_ATRCA (Short chain alcohol dehydrogenase-like protein OS=Atriplex canescens PE=2 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.000e-19 Identity = 48/69 (69.57%), Postives = 61/69 (88.41%), Query Frame = 1
BLAST of Spo10180.1 vs. UniProtKB/TrEMBL
Match: A0A0J8CG32_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_4g088210 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.500e-18 Identity = 45/64 (70.31%), Postives = 56/64 (87.50%), Query Frame = 1
BLAST of Spo10180.1 vs. UniProtKB/TrEMBL
Match: A0A0J8CKX4_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_4g088200 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.100e-17 Identity = 43/62 (69.35%), Postives = 54/62 (87.10%), Query Frame = 1
BLAST of Spo10180.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QQY6_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_156640 PE=4 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 5.700e-15 Identity = 43/47 (91.49%), Postives = 44/47 (93.62%), Query Frame = 1
BLAST of Spo10180.1 vs. ExPASy Swiss-Prot
Match: TRNHC_ARATH (Tropinone reductase homolog At2g29360 OS=Arabidopsis thaliana GN=SDR PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.100e-14 Identity = 37/58 (63.79%), Postives = 48/58 (82.76%), Query Frame = 1
BLAST of Spo10180.1 vs. ExPASy Swiss-Prot
Match: TRNHF_ARATH (Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.800e-14 Identity = 36/53 (67.92%), Postives = 45/53 (84.91%), Query Frame = 1
BLAST of Spo10180.1 vs. ExPASy Swiss-Prot
Match: TRNH4_ARATH (Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.400e-14 Identity = 35/55 (63.64%), Postives = 46/55 (83.64%), Query Frame = 1
BLAST of Spo10180.1 vs. ExPASy Swiss-Prot
Match: TRNHD_ARATH (Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana GN=At2g29370 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 9.100e-14 Identity = 37/53 (69.81%), Postives = 44/53 (83.02%), Query Frame = 1
BLAST of Spo10180.1 vs. ExPASy Swiss-Prot
Match: TRNH8_ARATH (Tropinone reductase homolog At2g29310 OS=Arabidopsis thaliana GN=At2g29310 PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.600e-13 Identity = 34/51 (66.67%), Postives = 43/51 (84.31%), Query Frame = 1
BLAST of Spo10180.1 vs. TAIR (Arabidopsis)
Match: AT2G29360.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 80.1 bits (196), Expect = 6.100e-16 Identity = 37/58 (63.79%), Postives = 48/58 (82.76%), Query Frame = 1
BLAST of Spo10180.1 vs. TAIR (Arabidopsis)
Match: AT5G06060.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 79.3 bits (194), Expect = 1.000e-15 Identity = 36/53 (67.92%), Postives = 45/53 (84.91%), Query Frame = 1
BLAST of Spo10180.1 vs. TAIR (Arabidopsis)
Match: AT2G29370.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 77.0 bits (188), Expect = 5.100e-15 Identity = 37/53 (69.81%), Postives = 44/53 (83.02%), Query Frame = 1
BLAST of Spo10180.1 vs. TAIR (Arabidopsis)
Match: AT2G29310.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 75.5 bits (184), Expect = 1.500e-14 Identity = 34/51 (66.67%), Postives = 43/51 (84.31%), Query Frame = 1
BLAST of Spo10180.1 vs. TAIR (Arabidopsis)
Match: AT1G07440.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 73.9 bits (180), Expect = 4.300e-14 Identity = 34/52 (65.38%), Postives = 42/52 (80.77%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo10180.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo10180.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo10180.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5
BLAST of Spo10180.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 5
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|