Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCCTCCGTCCTCTCCTCCGCCGCTGTCGCCACCGTCAGCCGTACCCCGGCTCAAGCCAGCATGGTGGCTCCTTTCACCGGCTTGAAGTCTACCGTAGGCTTCCCTGCCACCAAGAAGAACGATGACATTACCTCCCTTGCTAGCAACGGTGGAAGAGTCCAGTGCATGAAGGNACCAAGAAGAACGATGACATTACCTCCCTTGCTAGCAACGGTGGAAGAGTCCAGTGCATGA ATGGCTTCCTCCGTCCTCTCCTCCGCCGCTGTCGCCACCGTCAGCCGTACCCCGGCTCAAGCCAGCATGGTGGCTCCTTTCACCGGCTTGAAGTCTACCGTAGGCTTCCCTGCCACCAAGAAGAACGATGACATTACCTCCCTTGCTAGCAACGGTGGAAGAGTCCAGTGCATGAAGGNACCAAGAAGAACGATGACATTACCTCCCTTGCTAGCAACGGTGGAAGAGTCCAGTGCATGA ATGGCTTCCTCCGTCCTCTCCTCCGCCGCTGTCGCCACCGTCAGCCGTACCCCGGCTCAAGCCAGCATGGTGGCTCCTTTCACCGGCTTGAAGTCTACCGTAGGCTTCCCTGCCACCAAGAAGAACGATGACATTACCTCCCTTGCTAGCAACGGTGGAAGAGTCCAGTGCATGAAGGNACCAAGAAGAACGATGACATTACCTCCCTTGCTAGCAACGGTGGAAGAGTCCAGTGCATGA MASSVLSSAAVATVSRTPAQASMVAPFTGLKSTVGFPATKKNDDITSLASNGGRVQCMKXPRRTMTLPPLLATVEESSA Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Homology
BLAST of Spo12438.1 vs. NCBI nr
Match: gi|902213966|gb|KNA17382.1| (hypothetical protein SOVF_080400 [Spinacia oleracea]) HSP 1 Score: 109.4 bits (272), Expect = 2.900e-21 Identity = 65/78 (83.33%), Postives = 66/78 (84.62%), Query Frame = 1
BLAST of Spo12438.1 vs. NCBI nr
Match: gi|3914583|sp|Q43832.1|RBS2_SPIOL (RecName: Full=Ribulose bisphosphate carboxylase small chain 2, chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor) HSP 1 Score: 109.4 bits (272), Expect = 2.900e-21 Identity = 65/78 (83.33%), Postives = 66/78 (84.62%), Query Frame = 1
BLAST of Spo12438.1 vs. NCBI nr
Match: gi|2529378|gb|AAB81105.1| (ribulose 1,5-bisphosphate carboxylase small subunit [Spinacia oleracea]) HSP 1 Score: 107.5 bits (267), Expect = 1.100e-20 Identity = 64/78 (82.05%), Postives = 65/78 (83.33%), Query Frame = 1
BLAST of Spo12438.1 vs. NCBI nr
Match: gi|731315819|ref|XP_010693073.1| (PREDICTED: ribulose bisphosphate carboxylase small chain-like [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 100.1 bits (248), Expect = 1.800e-18 Identity = 54/59 (91.53%), Postives = 55/59 (93.22%), Query Frame = 1
BLAST of Spo12438.1 vs. NCBI nr
Match: gi|731315817|ref|XP_010693059.1| (PREDICTED: ribulose bisphosphate carboxylase small chain [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 99.4 bits (246), Expect = 3.000e-18 Identity = 53/59 (89.83%), Postives = 55/59 (93.22%), Query Frame = 1
BLAST of Spo12438.1 vs. UniProtKB/TrEMBL
Match: A0A0K9REV1_SPIOL (Ribulose bisphosphate carboxylase small chain OS=Spinacia oleracea GN=SOVF_080400 PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.000e-21 Identity = 65/78 (83.33%), Postives = 66/78 (84.62%), Query Frame = 1
BLAST of Spo12438.1 vs. UniProtKB/TrEMBL
Match: A0A0K9RD37_SPIOL (Ribulose bisphosphate carboxylase small chain OS=Spinacia oleracea GN=SOVF_080380 PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.000e-21 Identity = 65/78 (83.33%), Postives = 66/78 (84.62%), Query Frame = 1
BLAST of Spo12438.1 vs. UniProtKB/TrEMBL
Match: O20253_SPIOL (Ribulose bisphosphate carboxylase small chain OS=Spinacia oleracea GN=rbcS PE=2 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 7.800e-21 Identity = 64/78 (82.05%), Postives = 65/78 (83.33%), Query Frame = 1
BLAST of Spo12438.1 vs. UniProtKB/TrEMBL
Match: A0A0J8CXV4_BETVU (Ribulose bisphosphate carboxylase small chain OS=Beta vulgaris subsp. vulgaris GN=BVRB_2g026840 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.200e-18 Identity = 54/59 (91.53%), Postives = 55/59 (93.22%), Query Frame = 1
BLAST of Spo12438.1 vs. UniProtKB/TrEMBL
Match: A0A0J8FS61_BETVU (Ribulose bisphosphate carboxylase small chain OS=Beta vulgaris subsp. vulgaris GN=BVRB_2g026850 PE=3 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.100e-18 Identity = 53/59 (89.83%), Postives = 55/59 (93.22%), Query Frame = 1
BLAST of Spo12438.1 vs. ExPASy Swiss-Prot
Match: RBS2_SPIOL (Ribulose bisphosphate carboxylase small chain 2, chloroplastic OS=Spinacia oleracea GN=RBCS2 PE=1 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.800e-23 Identity = 65/78 (83.33%), Postives = 66/78 (84.62%), Query Frame = 1
BLAST of Spo12438.1 vs. ExPASy Swiss-Prot
Match: RBS1_MESCR (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Mesembryanthemum crystallinum GN=RBCS-1 PE=2 SV=2) HSP 1 Score: 90.5 bits (223), Expect = 8.800e-18 Identity = 47/59 (79.66%), Postives = 54/59 (91.53%), Query Frame = 1
BLAST of Spo12438.1 vs. ExPASy Swiss-Prot
Match: RBS_FAGCR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Fagus crenata GN=RBCS1 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.400e-17 Identity = 51/61 (83.61%), Postives = 56/61 (91.80%), Query Frame = 1
BLAST of Spo12438.1 vs. ExPASy Swiss-Prot
Match: RBS_CUCSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Cucumis sativus GN=RBCS PE=2 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.400e-15 Identity = 47/61 (77.05%), Postives = 55/61 (90.16%), Query Frame = 1
BLAST of Spo12438.1 vs. ExPASy Swiss-Prot
Match: RBS_HEVBR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Hevea brasiliensis GN=RBCS PE=2 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.800e-14 Identity = 45/61 (73.77%), Postives = 53/61 (86.89%), Query Frame = 1
BLAST of Spo12438.1 vs. TAIR (Arabidopsis)
Match: AT5G38410.3 (Ribulose bisphosphate carboxylase (small chain) family protein) HSP 1 Score: 75.5 bits (184), Expect = 1.700e-14 Identity = 44/60 (73.33%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of Spo12438.1 vs. TAIR (Arabidopsis)
Match: AT5G38430.1 (Ribulose bisphosphate carboxylase (small chain) family protein) HSP 1 Score: 74.7 bits (182), Expect = 2.800e-14 Identity = 43/60 (71.67%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of Spo12438.1 vs. TAIR (Arabidopsis)
Match: AT5G38420.1 (Ribulose bisphosphate carboxylase (small chain) family protein) HSP 1 Score: 71.6 bits (174), Expect = 2.400e-13 Identity = 41/60 (68.33%), Postives = 48/60 (80.00%), Query Frame = 1
BLAST of Spo12438.1 vs. TAIR (Arabidopsis)
Match: AT1G67090.1 (ribulose bisphosphate carboxylase small chain 1A) HSP 1 Score: 69.7 bits (169), Expect = 9.100e-13 Identity = 40/60 (66.67%), Postives = 49/60 (81.67%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo12438.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo12438.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo12438.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5
BLAST of Spo12438.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 4
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|