Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTATCAGATTCCCTTCTATGCTATCTACTGCAAAACAAATCCTTAGCAGAAATCAGCATACAGCAGCAGTTCCAAAAGGTCATATCCCAGTTTACGTAGGTGATCAGGCTAACAAGAAGAGACATGTAGTGCCACTTTCATACTTAAGCCACCCTGCATTCCAATGCATGTTACACCATGCTGAACAAGAGTTCGGTTTTCATCATCTTATGGGTGGTCTGACGATTCCATGCTCCGAAGAAACATTCTTTGAACTAACTTCTGTACTCAAGTGCTAG ATGGCTATCAGATTCCCTTCTATGCTATCTACTGCAAAACAAATCCTTAGCAGAAATCAGCATACAGCAGCAGTTCCAAAAGGTCATATCCCAGTTTACGTAGGTGATCAGGCTAACAAGAAGAGACATGTAGTGCCACTTTCATACTTAAGCCACCCTGCATTCCAATGCATGTTACACCATGCTGAACAAGAGTTCGGTTTTCATCATCTTATGGGTGGTCTGACGATTCCATGCTCCGAAGAAACATTCTTTGAACTAACTTCTGTACTCAAGTGCTAG ATGGCTATCAGATTCCCTTCTATGCTATCTACTGCAAAACAAATCCTTAGCAGAAATCAGCATACAGCAGCAGTTCCAAAAGGTCATATCCCAGTTTACGTAGGTGATCAGGCTAACAAGAAGAGACATGTAGTGCCACTTTCATACTTAAGCCACCCTGCATTCCAATGCATGTTACACCATGCTGAACAAGAGTTCGGTTTTCATCATCTTATGGGTGGTCTGACGATTCCATGCTCCGAAGAAACATTCTTTGAACTAACTTCTGTACTCAAGTGCTAG MAIRFPSMLSTAKQILSRNQHTAAVPKGHIPVYVGDQANKKRHVVPLSYLSHPAFQCMLHHAEQEFGFHHLMGGLTIPCSEETFFELTSVLKC Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Homology
BLAST of Spo14073.1 vs. NCBI nr
Match: gi|902225502|gb|KNA20089.1| (hypothetical protein SOVF_055590 [Spinacia oleracea]) HSP 1 Score: 143.3 bits (360), Expect = 2.200e-31 Identity = 71/93 (76.34%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of Spo14073.1 vs. NCBI nr
Match: gi|731360102|ref|XP_010691635.1| (PREDICTED: auxin-induced protein 15A-like [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 142.5 bits (358), Expect = 3.700e-31 Identity = 70/93 (75.27%), Postives = 81/93 (87.10%), Query Frame = 1
BLAST of Spo14073.1 vs. NCBI nr
Match: gi|870848795|gb|KMT01084.1| (hypothetical protein BVRB_9g223390 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 141.7 bits (356), Expect = 6.300e-31 Identity = 68/93 (73.12%), Postives = 80/93 (86.02%), Query Frame = 1
BLAST of Spo14073.1 vs. NCBI nr
Match: gi|731360098|ref|XP_010691632.1| (PREDICTED: auxin-induced protein 15A-like [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 141.4 bits (355), Expect = 8.200e-31 Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of Spo14073.1 vs. NCBI nr
Match: gi|731360100|ref|XP_010691633.1| (PREDICTED: auxin-induced protein 15A-like [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 141.4 bits (355), Expect = 8.200e-31 Identity = 68/93 (73.12%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of Spo14073.1 vs. UniProtKB/TrEMBL
Match: A0A0K9RMC7_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_055590 PE=4 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 1.500e-31 Identity = 71/93 (76.34%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of Spo14073.1 vs. UniProtKB/TrEMBL
Match: A0A0J8BM81_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_9g223490 PE=4 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 2.600e-31 Identity = 70/93 (75.27%), Postives = 81/93 (87.10%), Query Frame = 1
BLAST of Spo14073.1 vs. UniProtKB/TrEMBL
Match: A0A0J8BM70_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_9g223390 PE=4 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 4.400e-31 Identity = 68/93 (73.12%), Postives = 80/93 (86.02%), Query Frame = 1
BLAST of Spo14073.1 vs. UniProtKB/TrEMBL
Match: A0A0J8EDP6_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_9g223460 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 5.700e-31 Identity = 68/93 (73.12%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of Spo14073.1 vs. UniProtKB/TrEMBL
Match: A0A0J8BM03_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_9g223430 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 5.700e-31 Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of Spo14073.1 vs. ExPASy Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.500e-19 Identity = 49/81 (60.49%), Postives = 64/81 (79.01%), Query Frame = 1
BLAST of Spo14073.1 vs. ExPASy Swiss-Prot
Match: SAU19_ARATH (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana GN=SAUR19 PE=2 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 3.200e-19 Identity = 50/89 (56.18%), Postives = 65/89 (73.03%), Query Frame = 1
BLAST of Spo14073.1 vs. ExPASy Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 9.400e-19 Identity = 48/86 (55.81%), Postives = 63/86 (73.26%), Query Frame = 1
BLAST of Spo14073.1 vs. ExPASy Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.200e-18 Identity = 48/89 (53.93%), Postives = 65/89 (73.03%), Query Frame = 1
BLAST of Spo14073.1 vs. ExPASy Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.600e-18 Identity = 48/84 (57.14%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of Spo14073.1 vs. TAIR (Arabidopsis)
Match: AT2G21210.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 107.1 bits (266), Expect = 6.100e-24 Identity = 51/94 (54.26%), Postives = 68/94 (72.34%), Query Frame = 1
BLAST of Spo14073.1 vs. TAIR (Arabidopsis)
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 101.7 bits (252), Expect = 2.500e-22 Identity = 54/97 (55.67%), Postives = 67/97 (69.07%), Query Frame = 1
BLAST of Spo14073.1 vs. TAIR (Arabidopsis)
Match: AT4G34790.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 96.7 bits (239), Expect = 8.200e-21 Identity = 51/96 (53.12%), Postives = 63/96 (65.62%), Query Frame = 1
BLAST of Spo14073.1 vs. TAIR (Arabidopsis)
Match: AT5G18030.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 96.7 bits (239), Expect = 8.200e-21 Identity = 49/81 (60.49%), Postives = 64/81 (79.01%), Query Frame = 1
BLAST of Spo14073.1 vs. TAIR (Arabidopsis)
Match: AT4G34770.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 95.5 bits (236), Expect = 1.800e-20 Identity = 49/94 (52.13%), Postives = 63/94 (67.02%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo14073.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo14073.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo14073.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5
BLAST of Spo14073.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 5
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|