Spo15215 (gene)

Overview
NameSpo15215
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
Locationchr4 : 13244932 .. 13245174 (-)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGAATACTCATTGTTTAGTCTTAACTTACCGCGTCTTATATGAGTCCACCAAAAATCCAATTAACCATTTTCTCTCTCCTCTTTCTCTCTCTGAACTTTTCTTCTTCACTGCTGTTCATTCTTCGAATCCATCAAATTATTCATTAAATTCTCAATTTCCCATAAAATCCCAGAATTATTCTGCTTTCTTTGATTACACACAAAGTACCCTATTGATTCTCTCTCCTCAAACCAAAATCTAA

mRNA sequence

ATGAATACTCATTGTTTAGTCTTAACTTACCGCGTCTTATATGAGTCCACCAAAAATCCAATTAACCATTTTCTCTCTCCTCTTTCTCTCTCTGAACTTTTCTTCTTCACTGCTGTTCATTCTTCGAATCCATCAAATTATTCATTAAATTCTCAATTTCCCATAAAATCCCAGAATTATTCTGCTTTCTTTGATTACACACAAAGTACCCTATTGATTCTCTCTCCTCAAACCAAAATCTAA

Coding sequence (CDS)

ATGAATACTCATTGTTTAGTCTTAACTTACCGCGTCTTATATGAGTCCACCAAAAATCCAATTAACCATTTTCTCTCTCCTCTTTCTCTCTCTGAACTTTTCTTCTTCACTGCTGTTCATTCTTCGAATCCATCAAATTATTCATTAAATTCTCAATTTCCCATAAAATCCCAGAATTATTCTGCTTTCTTTGATTACACACAAAGTACCCTATTGATTCTCTCTCCTCAAACCAAAATCTAA

Protein sequence

MNTHCLVLTYRVLYESTKNPINHFLSPLSLSELFFFTAVHSSNPSNYSLNSQFPIKSQNYSAFFDYTQSTLLILSPQTKI
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo15215.1Spo15215.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo15215.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo15215.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo15215.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo15215.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0010260 animal organ senescence
biological_process GO:0016117 carotenoid biosynthetic process
biological_process GO:0010207 photosystem II assembly
biological_process GO:0009773 photosynthetic electron transport in photosystem I
biological_process GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
biological_process GO:0019497 hexachlorocyclohexane metabolic process
biological_process GO:0019344 cysteine biosynthetic process
biological_process GO:0015995 chlorophyll biosynthetic process
biological_process GO:0006470 protein dephosphorylation
biological_process GO:0009657 plastid organization
biological_process GO:0010286 heat acclimation
biological_process GO:0000302 response to reactive oxygen species
biological_process GO:0051302 regulation of cell division
biological_process GO:0017009 protein-phycocyanobilin linkage
biological_process GO:0006468 protein phosphorylation
biological_process GO:0009231 riboflavin biosynthetic process
biological_process GO:0010206 photosystem II repair
biological_process GO:0035304 regulation of protein dephosphorylation
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0006098 pentose-phosphate shunt
biological_process GO:0009414 response to water deprivation
biological_process GO:0006979 response to oxidative stress
biological_process GO:0006662 glycerol ether metabolic process
biological_process GO:0045454 cell redox homeostasis
biological_process GO:0010027 thylakoid membrane organization
biological_process GO:0042793 plastid transcription
biological_process GO:0042742 defense response to bacterium
biological_process GO:0009637 response to blue light
biological_process GO:0009902 chloroplast relocation
biological_process GO:0006636 unsaturated fatty acid biosynthetic process
biological_process GO:0006364 rRNA processing
biological_process GO:0006771 riboflavin metabolic process
biological_process GO:0010114 response to red light
biological_process GO:0010218 response to far red light
biological_process GO:0016310 phosphorylation
biological_process GO:0010020 chloroplast fission
biological_process GO:0033591 response to L-ascorbic acid
biological_process GO:0030244 cellulose biosynthetic process
biological_process GO:0042908 xenobiotic transport
biological_process GO:0019761 glucosinolate biosynthetic process
biological_process GO:0006000 fructose metabolic process
biological_process GO:0009298 GDP-mannose biosynthetic process
biological_process GO:0019853 L-ascorbic acid biosynthetic process
biological_process GO:0006013 mannose metabolic process
biological_process GO:0009646 response to absence of light
biological_process GO:0046686 response to cadmium ion
biological_process GO:0046680 response to DDT
biological_process GO:0009744 response to sucrose
biological_process GO:0010043 response to zinc ion
biological_process GO:0006084 acetyl-CoA metabolic process
biological_process GO:0000023 maltose metabolic process
biological_process GO:0006855 drug transmembrane transport
biological_process GO:0016132 brassinosteroid biosynthetic process
biological_process GO:0019252 starch biosynthetic process
biological_process GO:0048193 Golgi vesicle transport
biological_process GO:0006621 protein retention in ER lumen
biological_process GO:0015031 protein transport
biological_process GO:0016126 sterol biosynthetic process
biological_process GO:0010204 defense response signaling pathway, resistance gene-independent
cellular_component GO:0009349 riboflavin synthase complex
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0009534 chloroplast thylakoid
cellular_component GO:0031977 thylakoid lumen
cellular_component GO:0009535 chloroplast thylakoid membrane
cellular_component GO:0009570 chloroplast stroma
cellular_component GO:0009941 chloroplast envelope
cellular_component GO:0005789 endoplasmic reticulum membrane
cellular_component GO:0005886 plasma membrane
cellular_component GO:0009507 chloroplast
cellular_component GO:0005794 Golgi apparatus
cellular_component GO:0005737 cytoplasm
cellular_component GO:0005634 nucleus
cellular_component GO:0005840 ribosome
cellular_component GO:0009707 chloroplast outer membrane
cellular_component GO:0016020 membrane
molecular_function GO:0005524 ATP binding
molecular_function GO:0003723 RNA binding
molecular_function GO:0004672 protein kinase activity
molecular_function GO:0009055 electron transfer activity
molecular_function GO:0046923 ER retention sequence binding
molecular_function GO:0003993 acid phosphatase activity
molecular_function GO:0008559 xenobiotic transmembrane transporting ATPase activity
molecular_function GO:0004476 mannose-6-phosphate isomerase activity
molecular_function GO:0008270 zinc ion binding
molecular_function GO:0004721 phosphoprotein phosphatase activity
molecular_function GO:0046872 metal ion binding
molecular_function GO:0016829 lyase activity
molecular_function GO:0004746 riboflavin synthase activity
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0005515 protein binding
molecular_function GO:0016301 kinase activity
molecular_function GO:0032440 2-alkenal reductase [NAD(P)] activity
molecular_function GO:0015035 protein disulfide oxidoreductase activity
RNA-Seq Expression