Spo08271 (gene) | SpinachBase

Overview


Name	Spo08271
Type	gene
Organism	Spinacia oleracea (Spinach)
Description	Unknown protein
Location	SpoScf_01367 : 96126 .. 96434 (+)

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideexonCDS

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGACTCATGGTCAAAGGCCAAAGCCTATGGAAGAGCACACACCGCTTTCTTTCGTTTCAGGAAAAAAAATCTGTATTCTTTCGAACCCCCAAAGCTTGCTGTGTCTTGCTGACTTTTCTCTTTCTCTCTCCTCCCCCTCTTCCTCTCTCTTTATCTCTCCTCCAAAGGGTGTTCAATCTTTCCCATGGCGCTTCTCAATCTCACAACCTCCTTTCGATCGCCTCTTTGAAGCACAGGCAAAGGAGGGAGATTTTGTCGCTCCAATTTTCTCGATTTCCCCACTTGAAATAAGCTCAAGCTTCACCTAA

mRNA sequence

ATGACTCATGGTCAAAGGCCAAAGCCTATGGAAGAGCACACACCGCTTTCTTTCGTTTCAGGAAAAAAAATCTGTATTCTTTCGAACCCCCAAAGCTTGCTGTGTCTTGCTGACTTTTCTCTTTCTCTCTCCTCCCCCTCTTCCTCTCTCTTTATCTCTCCTCCAAAGGGTGTTCAATCTTTCCCATGGCGCTTCTCAATCTCACAACCTCCTTTCGATCGCCTCTTTGAAGCACAGGCAAAGGAGGGAGATTTTGTCGCTCCAATTTTCTCGATTTCCCCACTTGAAATAAGCTCAAGCTTCACCTAA

Coding sequence (CDS)

ATGACTCATGGTCAAAGGCCAAAGCCTATGGAAGAGCACACACCGCTTTCTTTCGTTTCAGGAAAAAAAATCTGTATTCTTTCGAACCCCCAAAGCTTGCTGTGTCTTGCTGACTTTTCTCTTTCTCTCTCCTCCCCCTCTTCCTCTCTCTTTATCTCTCCTCCAAAGGGTGTTCAATCTTTCCCATGGCGCTTCTCAATCTCACAACCTCCTTTCGATCGCCTCTTTGAAGCACAGGCAAAGGAGGGAGATTTTGTCGCTCCAATTTTCTCGATTTCCCCACTTGAAATAAGCTCAAGCTTCACCTAA

Protein sequence

MTHGQRPKPMEEHTPLSFVSGKKICILSNPQSLLCLADFSLSLSSPSSSLFISPPKGVQSFPWRFSISQPPFDRLFEAQAKEGDFVAPIFSISPLEISSSFT

Relationships

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Type
Spo08271.1	Spo08271.1	mRNA

Homology

The following BLAST results are available for this feature:

BLAST of Spo08271.1 vs. NCBI nr
BLAST of Spo08271.1 vs. UniProtKB/TrEMBL
BLAST of Spo08271.1 vs. ExPASy Swiss-Prot
BLAST of Spo08271.1 vs. TAIR (Arabidopsis)

BLAST of Spo08271.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo08271.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo08271.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo08271.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

GO Annotation

GO Assignments

This gene is annotated with the following GO terms.

Category	Term Accession	Term Name
biological_process	GO:0061025	membrane fusion
biological_process	GO:0009729	detection of brassinosteroid stimulus
biological_process	GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic
biological_process	GO:0007033	vacuole organization
biological_process	GO:0006891	intra-Golgi vesicle-mediated transport
biological_process	GO:0006890	retrograde vesicle-mediated transport, Golgi to ER
biological_process	GO:0048657	anther wall tapetum cell differentiation
biological_process	GO:0043481	anthocyanin accumulation in tissues in response to UV light
biological_process	GO:0009742	brassinosteroid mediated signaling pathway
biological_process	GO:0009932	cell tip growth
biological_process	GO:0071555	cell wall organization
biological_process	GO:0042742	defense response to bacterium
biological_process	GO:0048366	leaf development
biological_process	GO:0048193	Golgi vesicle transport
biological_process	GO:0009825	multidimensional cell growth
biological_process	GO:0060548	negative regulation of cell death
biological_process	GO:0010584	pollen exine formation
biological_process	GO:0000271	polysaccharide biosynthetic process
biological_process	GO:0009911	positive regulation of flower development
biological_process	GO:0010817	regulation of hormone levels
biological_process	GO:1900140	regulation of seedling development
biological_process	GO:0002237	response to molecule of bacterial origin
biological_process	GO:0010224	response to UV-B
biological_process	GO:0048767	root hair elongation
biological_process	GO:0010103	stomatal complex morphogenesis
biological_process	GO:0006355	regulation of transcription, DNA-templated
biological_process	GO:0010228	vegetative to reproductive phase transition of meristem
biological_process	GO:0007030	Golgi organization
biological_process	GO:0000902	cell morphogenesis
biological_process	GO:0009395	phospholipid catabolic process
biological_process	GO:0071369	cellular response to ethylene stimulus
biological_process	GO:0071281	cellular response to iron ion
biological_process	GO:0071732	cellular response to nitric oxide
biological_process	GO:0019509	L-methionine salvage from methylthioadenosine
biological_process	GO:0016310	phosphorylation
biological_process	GO:0042967	obsolete acyl-carrier-protein biosynthetic process
biological_process	GO:0009816	defense response to bacterium, incompatible interaction
biological_process	GO:0018108	peptidyl-tyrosine phosphorylation
biological_process	GO:0046777	protein autophosphorylation
biological_process	GO:0009069	serine family amino acid metabolic process
biological_process	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway
biological_process	GO:0006810	transport
biological_process	GO:0016049	cell growth
cellular_component	GO:0005801	cis-Golgi network
cellular_component	GO:0005783	endoplasmic reticulum
cellular_component	GO:0016021	integral component of membrane
cellular_component	GO:0005794	Golgi apparatus
cellular_component	GO:0005622	intracellular
cellular_component	GO:0010008	endosome membrane
cellular_component	GO:0005634	nucleus
cellular_component	GO:0005829	cytosol
cellular_component	GO:0005886	plasma membrane
cellular_component	GO:0005789	endoplasmic reticulum membrane
cellular_component	GO:0032991	protein-containing complex
cellular_component	GO:0005737	cytoplasm
cellular_component	GO:0005777	peroxisome
cellular_component	GO:0005739	mitochondrion
molecular_function	GO:0005198	structural molecule activity
molecular_function	GO:0005496	steroid binding
molecular_function	GO:0046982	protein heterodimerization activity
molecular_function	GO:0004714	transmembrane receptor protein tyrosine kinase activity
molecular_function	GO:0047617	acyl-CoA hydrolase activity
molecular_function	GO:0008374	O-acyltransferase activity
molecular_function	GO:0042803	protein homodimerization activity
molecular_function	GO:0005515	protein binding
molecular_function	GO:0016740	transferase activity
molecular_function	GO:0003723	RNA binding
molecular_function	GO:0004535	poly(A)-specific ribonuclease activity
molecular_function	GO:0046872	metal ion binding
molecular_function	GO:0005215	transporter activity
molecular_function	GO:0004674	protein serine/threonine kinase activity
molecular_function	GO:0004715	non-membrane spanning protein tyrosine kinase activity
molecular_function	GO:0046522	S-methyl-5-thioribose kinase activity
molecular_function	GO:0042802	identical protein binding
molecular_function	GO:0005524	ATP binding
molecular_function	GO:0016757	transferase activity, transferring glycosyl groups
molecular_function	GO:0033925	mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity
molecular_function	GO:0004620	phospholipase activity

RNA-Seq Expression

Co-expression


Gene	r value	Expression
Spo05135	0.76	Barchart \| Table
Spo25483	0.74	Barchart \| Table
Spo21214	0.73	Barchart \| Table
Spo05627	0.72	Barchart \| Table
Spo09290	0.71	Barchart \| Table
Spo06919	0.71	Barchart \| Table
Spo08850	0.71	Barchart \| Table
Spo14342	0.71	Barchart \| Table
Spo04907	0.70	Barchart \| Table
Spo13029	0.70	Barchart \| Table
Spo05093	0.70	Barchart \| Table
Spo27081	0.70	Barchart \| Table
Spo18800	0.69	Barchart \| Table
Spo11918	0.69	Barchart \| Table
Spo11339	0.69	Barchart \| Table
Spo01858	0.69	Barchart \| Table
Spo24607	0.69	Barchart \| Table
Spo26424	0.69	Barchart \| Table
Spo28058	0.68	Barchart \| Table
Spo17610	0.68	Barchart \| Table
Spo02486	0.68	Barchart \| Table
Spo00362	0.68	Barchart \| Table
Spo22028	0.68	Barchart \| Table
Spo22529	0.68	Barchart \| Table
Spo13952	0.68	Barchart \| Table
Spo08435	0.68	Barchart \| Table
Spo13518	0.68	Barchart \| Table
Spo11747	0.68	Barchart \| Table
Spo10316	0.68	Barchart \| Table
Spo03662	0.68	Barchart \| Table
Spo02010	0.67	Barchart \| Table
Spo02107	0.67	Barchart \| Table
Spo02932	0.67	Barchart \| Table
Spo06506	0.67	Barchart \| Table
Spo08521	0.67	Barchart \| Table
Spo08572	0.67	Barchart \| Table
Spo09499	0.67	Barchart \| Table
Spo11923	0.67	Barchart \| Table
Spo14225	0.67	Barchart \| Table
Spo14881	0.67	Barchart \| Table
Spo15639	0.67	Barchart \| Table
Spo15873	0.67	Barchart \| Table
Spo16652	0.67	Barchart \| Table
Spo16911	0.67	Barchart \| Table
Spo18997	0.67	Barchart \| Table
Spo24549	0.67	Barchart \| Table
Spo25043	0.67	Barchart \| Table
Spo05728	0.66	Barchart \| Table
Spo01184	0.66	Barchart \| Table
Spo03937	0.66	Barchart \| Table
Spo00114	0.66	Barchart \| Table
Spo01840	0.66	Barchart \| Table
Spo23751	0.66	Barchart \| Table
Spo00486	0.66	Barchart \| Table
Spo11623	0.66	Barchart \| Table
Spo10444	0.66	Barchart \| Table
Spo09940	0.66	Barchart \| Table
Spo13393	0.66	Barchart \| Table
Spo09605	0.66	Barchart \| Table
Spo25078	0.66	Barchart \| Table
Spo01104	0.66	Barchart \| Table
Spo17788	0.66	Barchart \| Table
Spo04863	0.66	Barchart \| Table
Spo19245	0.66	Barchart \| Table
Spo19599	0.66	Barchart \| Table
Spo20639	0.66	Barchart \| Table
Spo21130	0.66	Barchart \| Table
Spo25876	0.65	Barchart \| Table
Spo01261	0.65	Barchart \| Table
Spo26858	0.65	Barchart \| Table
Spo05227	0.65	Barchart \| Table
Spo07184	0.65	Barchart \| Table
Spo13503	0.65	Barchart \| Table
Spo27004	0.65	Barchart \| Table
Spo23658	0.65	Barchart \| Table
Spo23664	0.65	Barchart \| Table
Spo24752	0.65	Barchart \| Table
Spo00369	0.65	Barchart \| Table