Spo13210 (gene) | SpinachBase

Overview


Name	Spo13210
Type	gene
Organism	Spinacia oleracea (Spinach)
Description	Unknown protein
Location	SpoScf_01451 : 83647 .. 84003 (+)

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideexonCDS

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGGCAGAATCAATCCTATCAAATTCCGGCAAGGCTCCACCAAGTCCGGCCACCGTGAACGACGGAGAAGATGCCGTGGAGATCCGTCAATCAAAGAAGAGGAAAAACTGCCCAACTTTCTCTCTTCTTCAATTGAACAAAAAACTTATTGATGGGCAATCAAATTCAAGCTTTACCTTCTCTTTCCCCACTGATGAACTCACTACCACGACTCCCGATGTGACTCCCAAATTCGGATTCTTCAATTCGGGTAAGGATACGAGTACTGGGTTGTCGTCGGAAAGTGGCCGTTCTTGTCAAGCTCCAGCGAAGAACAGCGAGGGAATTACAGCGGTTGAAGAAGCTGACAAGATTTGA

mRNA sequence

ATGGCAGAATCAATCCTATCAAATTCCGGCAAGGCTCCACCAAGTCCGGCCACCGTGAACGACGGAGAAGATGCCGTGGAGATCCGTCAATCAAAGAAGAGGAAAAACTGCCCAACTTTCTCTCTTCTTCAATTGAACAAAAAACTTATTGATGGGCAATCAAATTCAAGCTTTACCTTCTCTTTCCCCACTGATGAACTCACTACCACGACTCCCGATGTGACTCCCAAATTCGGATTCTTCAATTCGGGTAAGGATACGAGTACTGGGTTGTCGTCGGAAAGTGGCCGTTCTTGTCAAGCTCCAGCGAAGAACAGCGAGGGAATTACAGCGGTTGAAGAAGCTGACAAGATTTGA

Coding sequence (CDS)

ATGGCAGAATCAATCCTATCAAATTCCGGCAAGGCTCCACCAAGTCCGGCCACCGTGAACGACGGAGAAGATGCCGTGGAGATCCGTCAATCAAAGAAGAGGAAAAACTGCCCAACTTTCTCTCTTCTTCAATTGAACAAAAAACTTATTGATGGGCAATCAAATTCAAGCTTTACCTTCTCTTTCCCCACTGATGAACTCACTACCACGACTCCCGATGTGACTCCCAAATTCGGATTCTTCAATTCGGGTAAGGATACGAGTACTGGGTTGTCGTCGGAAAGTGGCCGTTCTTGTCAAGCTCCAGCGAAGAACAGCGAGGGAATTACAGCGGTTGAAGAAGCTGACAAGATTTGA

Protein sequence

MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTFSFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI

Relationships

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Type
Spo13210.1	Spo13210.1	mRNA

Homology

[Close]

BLAST of Spo13210.1 vs. NCBI nr
Match: gi|902155097|gb|KNA05876.1| (hypothetical protein SOVF_186330 [Spinacia oleracea])

HSP 1 Score: 228.8 bits (582), Expect = 5.000e-57
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1

		  
Query: 1   MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF 60
           MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF
Sbjct: 1   MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF 60

Query: 61  SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI 119
           SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI
Sbjct: 61  SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI 118

[Close]

BLAST of Spo13210.1 vs. NCBI nr
Match: gi|870864128|gb|KMT15261.1| (hypothetical protein BVRB_3g063700 [Beta vulgaris subsp. vulgaris])

HSP 1 Score: 105.9 bits (263), Expect = 4.900e-20
Identity = 57/82 (69.51%), Postives = 66/82 (80.49%), Query Frame = 1

		  
Query: 7   SNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTFSFPTDE 66
           S+SGK P   AT+   +D VE R+SK+RKNCP+FSLLQL  K+IDGQSNSSF FSFPTDE
Sbjct: 31  SDSGKPPSIRATI---DDVVETRKSKRRKNCPSFSLLQL-NKIIDGQSNSSFNFSFPTDE 90

Query: 67  LTTTTPDVTPKFGFFNSGKDTS 89
           LTTTTP+ TPKFG FNSG  +S
Sbjct: 91  LTTTTPETTPKFGSFNSGHGSS 108

[Close]

BLAST of Spo13210.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QH23_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_186330 PE=4 SV=1)

HSP 1 Score: 228.8 bits (582), Expect = 3.500e-57
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1

		  
Query: 1   MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF 60
           MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF
Sbjct: 1   MAESILSNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTF 60

Query: 61  SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI 119
           SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI
Sbjct: 61  SFPTDELTTTTPDVTPKFGFFNSGKDTSTGLSSESGRSCQAPAKNSEGITAVEEADKI 118

[Close]

BLAST of Spo13210.1 vs. UniProtKB/TrEMBL
Match: A0A0J8FH80_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_3g063700 PE=4 SV=1)

HSP 1 Score: 105.9 bits (263), Expect = 3.400e-20
Identity = 57/82 (69.51%), Postives = 66/82 (80.49%), Query Frame = 1

		  
Query: 7   SNSGKAPPSPATVNDGEDAVEIRQSKKRKNCPTFSLLQLNKKLIDGQSNSSFTFSFPTDE 66
           S+SGK P   AT+   +D VE R+SK+RKNCP+FSLLQL  K+IDGQSNSSF FSFPTDE
Sbjct: 31  SDSGKPPSIRATI---DDVVETRKSKRRKNCPSFSLLQL-NKIIDGQSNSSFNFSFPTDE 90

Query: 67  LTTTTPDVTPKFGFFNSGKDTS 89
           LTTTTP+ TPKFG FNSG  +S
Sbjct: 91  LTTTTPETTPKFGSFNSGHGSS 108

The following BLAST results are available for this feature:

BLAST of Spo13210.1 vs. NCBI nr
BLAST of Spo13210.1 vs. UniProtKB/TrEMBL
BLAST of Spo13210.1 vs. ExPASy Swiss-Prot
BLAST of Spo13210.1 vs. TAIR (Arabidopsis)

BLAST of Spo13210.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 2

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description
gi\|902155097\|gb\|KNA05876.1\|	5.0e-57	100.	hypothetical protein SOVF_1863...	[more]
gi\|870864128\|gb\|KMT15261.1\|	4.9e-20	69.5	hypothetical protein BVRB_3g06...	[more]

BLAST of Spo13210.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 2

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description
A0A0K9QH23_SPIOL	3.5e-57	100.	Uncharacterized protein OS=Spi...	[more]
A0A0J8FH80_BETVU	3.4e-20	69.5	Uncharacterized protein OS=Bet...	[more]

BLAST of Spo13210.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

BLAST of Spo13210.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0

Position :

Zoom :

x 1


Match Name	E-value	Identity	Description

GO Annotation

GO Assignments

This gene is annotated with the following GO terms.

Category	Term Accession	Term Name
biological_process	GO:0006468	protein phosphorylation
biological_process	GO:0009737	response to abscisic acid
biological_process	GO:0000902	cell morphogenesis
biological_process	GO:0016049	cell growth
biological_process	GO:0048767	root hair elongation
biological_process	GO:0007267	cell-cell signaling
biological_process	GO:0019722	calcium-mediated signaling
biological_process	GO:0010951	negative regulation of endopeptidase activity
biological_process	GO:0008152	metabolic process
biological_process	GO:0009555	pollen development
biological_process	GO:0042744	hydrogen peroxide catabolic process
biological_process	GO:0009793	embryo development ending in seed dormancy
biological_process	GO:0006906	vesicle fusion
biological_process	GO:0010118	stomatal movement
biological_process	GO:0009651	response to salt stress
biological_process	GO:0010363	regulation of plant-type hypersensitive response
biological_process	GO:0007033	vacuole organization
biological_process	GO:0006612	protein targeting to membrane
biological_process	GO:0009963	positive regulation of flavonoid biosynthetic process
biological_process	GO:0006598	polyamine catabolic process
biological_process	GO:0009698	phenylpropanoid metabolic process
biological_process	GO:0046909	obsolete intermembrane transport
biological_process	GO:0006887	exocytosis
biological_process	GO:0042398	cellular modified amino acid biosynthetic process
biological_process	GO:0006816	calcium ion transport
biological_process	GO:0006412	translation
biological_process	GO:0042254	ribosome biogenesis
biological_process	GO:0030488	tRNA methylation
biological_process	GO:0006470	protein dephosphorylation
biological_process	GO:0080005	photosystem stoichiometry adjustment
biological_process	GO:0009767	photosynthetic electron transport chain
biological_process	GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic
biological_process	GO:0010228	vegetative to reproductive phase transition of meristem
biological_process	GO:0009616	virus induced gene silencing
biological_process	GO:0044262	cellular carbohydrate metabolic process
biological_process	GO:0032482	Rab protein signal transduction
biological_process	GO:0006623	protein targeting to vacuole
biological_process	GO:0006888	ER to Golgi vesicle-mediated transport
biological_process	GO:0006446	regulation of translational initiation
biological_process	GO:0009611	response to wounding
biological_process	GO:0009753	response to jasmonic acid
biological_process	GO:0009620	response to fungus
biological_process	GO:0006508	proteolysis
biological_process	GO:0009695	jasmonic acid biosynthetic process
biological_process	GO:0009738	abscisic acid-activated signaling pathway
biological_process	GO:0043069	negative regulation of programmed cell death
biological_process	GO:0030968	endoplasmic reticulum unfolded protein response
biological_process	GO:0052542	defense response by callose deposition
biological_process	GO:0009987	cellular process
biological_process	GO:0005975	carbohydrate metabolic process
biological_process	GO:0015994	chlorophyll metabolic process
biological_process	GO:0051090	regulation of DNA-binding transcription factor activity
biological_process	GO:0015991	ATP hydrolysis coupled proton transport
biological_process	GO:0006614	SRP-dependent cotranslational protein targeting to membrane
biological_process	GO:0045900	negative regulation of translational elongation
biological_process	GO:0032940	secretion by cell
biological_process	GO:0006913	nucleocytoplasmic transport
biological_process	GO:0006891	intra-Golgi vesicle-mediated transport
biological_process	GO:0006979	response to oxidative stress
biological_process	GO:0030091	protein repair
biological_process	GO:0006464	cellular protein modification process
biological_process	GO:0045454	cell redox homeostasis
biological_process	GO:0010024	phytochromobilin biosynthetic process
biological_process	GO:0019288	isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
biological_process	GO:0006788	heme oxidation
biological_process	GO:0010051	xylem and phloem pattern formation
biological_process	GO:0007030	Golgi organization
biological_process	GO:0010050	vegetative phase change
biological_process	GO:0006355	regulation of transcription, DNA-templated
biological_process	GO:0009734	auxin-activated signaling pathway
biological_process	GO:0010207	photosystem II assembly
biological_process	GO:0070676	intralumenal vesicle formation
biological_process	GO:0010158	abaxial cell fate specification
biological_process	GO:0055114	oxidation-reduction process
biological_process	GO:0006223	uracil salvage
biological_process	GO:0016573	histone acetylation
biological_process	GO:0042967	obsolete acyl-carrier-protein biosynthetic process
biological_process	GO:0044206	UMP salvage
biological_process	GO:0030244	cellulose biosynthetic process
biological_process	GO:0032502	developmental process
biological_process	GO:0007034	vacuolar transport
biological_process	GO:0006629	lipid metabolic process
biological_process	GO:0042542	response to hydrogen peroxide
biological_process	GO:0009644	response to high light intensity
biological_process	GO:0010200	response to chitin
biological_process	GO:0007264	small GTPase mediated signal transduction
biological_process	GO:0048193	Golgi vesicle transport
biological_process	GO:0015031	protein transport
biological_process	GO:0009850	auxin metabolic process
biological_process	GO:0009887	animal organ morphogenesis
biological_process	GO:0061025	membrane fusion
biological_process	GO:0046339	diacylglycerol metabolic process
biological_process	GO:0016042	lipid catabolic process
biological_process	GO:0031047	gene silencing by RNA
biological_process	GO:0006886	intracellular protein transport
biological_process	GO:0048519	negative regulation of biological process
biological_process	GO:0035556	intracellular signal transduction
biological_process	GO:0048439	flower morphogenesis
biological_process	GO:0048438	floral whorl development
biological_process	GO:0016556	mRNA modification
biological_process	GO:0010582	floral meristem determinacy
biological_process	GO:0009855	determination of bilateral symmetry
biological_process	GO:0046686	response to cadmium ion
biological_process	GO:0009395	phospholipid catabolic process
cellular_component	GO:0016021	integral component of membrane
cellular_component	GO:0005789	endoplasmic reticulum membrane
cellular_component	GO:0009507	chloroplast
cellular_component	GO:0005773	vacuole
cellular_component	GO:0044464	cell part
cellular_component	GO:0005667	transcription factor complex
cellular_component	GO:0000123	histone acetyltransferase complex
cellular_component	GO:0009536	plastid
cellular_component	GO:0016020	membrane
cellular_component	GO:0009941	chloroplast envelope
cellular_component	GO:0005768	endosome
cellular_component	GO:0000139	Golgi membrane
cellular_component	GO:0005802	trans-Golgi network
cellular_component	GO:0009523	photosystem II
cellular_component	GO:0005786	signal recognition particle, endoplasmic reticulum targeting
cellular_component	GO:0009535	chloroplast thylakoid membrane
cellular_component	GO:0033179	proton-transporting V-type ATPase, V0 domain
cellular_component	GO:0005794	Golgi apparatus
cellular_component	GO:0000785	chromatin
cellular_component	GO:0032040	small-subunit processome
cellular_component	GO:0048046	apoplast
cellular_component	GO:0005737	cytoplasm
cellular_component	GO:0005840	ribosome
cellular_component	GO:0005829	cytosol
cellular_component	GO:0031201	SNARE complex
cellular_component	GO:0005774	vacuolar membrane
cellular_component	GO:0009579	thylakoid
cellular_component	GO:0031515	tRNA (m1A) methyltransferase complex
cellular_component	GO:0005771	multivesicular body
cellular_component	GO:0000815	ESCRT III complex
cellular_component	GO:0008287	protein serine/threonine phosphatase complex
cellular_component	GO:0005730	nucleolus
cellular_component	GO:0005886	plasma membrane
cellular_component	GO:0009534	chloroplast thylakoid
cellular_component	GO:0005634	nucleus
cellular_component	GO:0005795	Golgi stack
cellular_component	GO:0009506	plasmodesma
cellular_component	GO:0009570	chloroplast stroma
molecular_function	GO:0003682	chromatin binding
molecular_function	GO:0043565	sequence-specific DNA binding
molecular_function	GO:0016429	tRNA (adenine-N1-)-methyltransferase activity
molecular_function	GO:0016757	transferase activity, transferring glycosyl groups
molecular_function	GO:0097159	organic cyclic compound binding
molecular_function	GO:1901363	heterocyclic compound binding
molecular_function	GO:0004722	protein serine/threonine phosphatase activity
molecular_function	GO:0005179	hormone activity
molecular_function	GO:0016788	hydrolase activity, acting on ester bonds
molecular_function	GO:0046872	metal ion binding
molecular_function	GO:0003735	structural constituent of ribosome
molecular_function	GO:0004435	phosphatidylinositol phospholipase C activity
molecular_function	GO:0004871	obsolete signal transducer activity
molecular_function	GO:0008234	cysteine-type peptidase activity
molecular_function	GO:0003700	DNA-binding transcription factor activity
molecular_function	GO:0003743	translation initiation factor activity
molecular_function	GO:0003677	DNA binding
molecular_function	GO:0004672	protein kinase activity
molecular_function	GO:0005515	protein binding
molecular_function	GO:0016787	hydrolase activity
molecular_function	GO:0046982	protein heterodimerization activity
molecular_function	GO:0004402	histone acetyltransferase activity
molecular_function	GO:0004535	poly(A)-specific ribonuclease activity
molecular_function	GO:0003723	RNA binding
molecular_function	GO:0016740	transferase activity
molecular_function	GO:0031072	heat shock protein binding
molecular_function	GO:0008233	peptidase activity
molecular_function	GO:0004869	cysteine-type endopeptidase inhibitor activity
molecular_function	GO:0008270	zinc ion binding
molecular_function	GO:0004392	heme oxygenase (decyclizing) activity
molecular_function	GO:0003712	transcription coregulator activity
molecular_function	GO:0016874	ligase activity
molecular_function	GO:0008430	selenium binding
molecular_function	GO:0008113	peptide-methionine (S)-S-oxide reductase activity
molecular_function	GO:0005524	ATP binding
molecular_function	GO:0000149	SNARE binding
molecular_function	GO:0005484	SNAP receptor activity
molecular_function	GO:0003924	GTPase activity
molecular_function	GO:0005509	calcium ion binding
molecular_function	GO:0005525	GTP binding
molecular_function	GO:0004845	uracil phosphoribosyltransferase activity
molecular_function	GO:0008312	7S RNA binding
molecular_function	GO:0005047	signal recognition particle binding
molecular_function	GO:0010181	FMN binding
molecular_function	GO:0016491	oxidoreductase activity
molecular_function	GO:0051082	unfolded protein binding
molecular_function	GO:0015078	proton transmembrane transporter activity
molecular_function	GO:0019003	GDP binding

RNA-Seq Expression

Co-expression


Gene	r value	Expression
Spo11524	0.81	Barchart \| Table
Spo04142	0.77	Barchart \| Table
Spo20106	0.76	Barchart \| Table
Spo11951	0.76	Barchart \| Table
Spo23382	0.76	Barchart \| Table
Spo11509	0.76	Barchart \| Table
Spo26013	0.74	Barchart \| Table
Spo04433	0.74	Barchart \| Table
Spo23249	0.74	Barchart \| Table
Spo09769	0.74	Barchart \| Table
Spo06335	0.74	Barchart \| Table
Spo13783	0.74	Barchart \| Table
Spo00748	0.73	Barchart \| Table
Spo09499	0.73	Barchart \| Table
Spo12589	0.73	Barchart \| Table
Spo02454	0.73	Barchart \| Table
Spo25817	0.73	Barchart \| Table
Spo02513	0.73	Barchart \| Table
Spo06885	0.73	Barchart \| Table
Spo00667	0.73	Barchart \| Table
Spo17161	0.72	Barchart \| Table
Spo19938	0.72	Barchart \| Table
Spo18828	0.72	Barchart \| Table
Spo15390	0.72	Barchart \| Table
Spo03903	0.72	Barchart \| Table
Spo25787	0.72	Barchart \| Table
Spo04941	0.72	Barchart \| Table
Spo00283	0.72	Barchart \| Table
Spo26045	0.71	Barchart \| Table
Spo23384	0.71	Barchart \| Table
Spo05402	0.71	Barchart \| Table
Spo12302	0.71	Barchart \| Table
Spo17250	0.71	Barchart \| Table
Spo21833	0.71	Barchart \| Table
Spo22999	0.71	Barchart \| Table
Spo12228	0.70	Barchart \| Table
Spo00205	0.70	Barchart \| Table
Spo01575	0.70	Barchart \| Table
Spo14232	0.70	Barchart \| Table
Spo10171	0.70	Barchart \| Table
Spo20952	0.70	Barchart \| Table
Spo13180	0.70	Barchart \| Table
Spo13281	0.69	Barchart \| Table
Spo16361	0.69	Barchart \| Table
Spo16996	0.69	Barchart \| Table
Spo26355	0.69	Barchart \| Table
Spo00362	0.69	Barchart \| Table
Spo03195	0.69	Barchart \| Table
Spo04104	0.69	Barchart \| Table
Spo05781	0.69	Barchart \| Table
Spo07236	0.69	Barchart \| Table
Spo09149	0.69	Barchart \| Table
Spo23286	0.69	Barchart \| Table
Spo27162	0.69	Barchart \| Table
Spo20912	0.69	Barchart \| Table
Spo22811	0.69	Barchart \| Table
Spo14779	0.69	Barchart \| Table
Spo14914	0.69	Barchart \| Table
Spo21446	0.69	Barchart \| Table
Spo22998	0.68	Barchart \| Table
Spo23712	0.68	Barchart \| Table
Spo23818	0.68	Barchart \| Table
Spo00872	0.68	Barchart \| Table
Spo11911	0.68	Barchart \| Table
Spo08997	0.68	Barchart \| Table
Spo01068	0.68	Barchart \| Table
Spo08783	0.68	Barchart \| Table
Spo07778	0.68	Barchart \| Table
Spo24068	0.68	Barchart \| Table
Spo06004	0.68	Barchart \| Table
Spo13171	0.68	Barchart \| Table
Spo24269	0.68	Barchart \| Table
Spo15499	0.68	Barchart \| Table
Spo20174	0.68	Barchart \| Table
Spo02947	0.68	Barchart \| Table
Spo19035	0.68	Barchart \| Table
Spo22451	0.68	Barchart \| Table
Spo10316	0.68	Barchart \| Table
Spo09752	0.68	Barchart \| Table
Spo10864	0.68	Barchart \| Table
Spo17612	0.68	Barchart \| Table
Spo11193	0.68	Barchart \| Table
Spo09428	0.68	Barchart \| Table
Spo27352	0.67	Barchart \| Table
Spo00405	0.67	Barchart \| Table
Spo00840	0.67	Barchart \| Table
Spo01261	0.67	Barchart \| Table
Spo02480	0.67	Barchart \| Table
Spo02648	0.67	Barchart \| Table
Spo06398	0.67	Barchart \| Table
Spo09636	0.67	Barchart \| Table
Spo10895	0.67	Barchart \| Table
Spo11688	0.67	Barchart \| Table
Spo12130	0.67	Barchart \| Table
Spo12370	0.67	Barchart \| Table
Spo17497	0.67	Barchart \| Table
Spo19217	0.67	Barchart \| Table
Spo19288	0.67	Barchart \| Table
Spo21159	0.67	Barchart \| Table
Spo21525	0.67	Barchart \| Table
Spo23283	0.67	Barchart \| Table
Spo23504	0.67	Barchart \| Table
Spo25659	0.67	Barchart \| Table
Spo26986	0.67	Barchart \| Table
Spo27081	0.67	Barchart \| Table
Spo04373	0.66	Barchart \| Table
Spo22666	0.66	Barchart \| Table
Spo02696	0.66	Barchart \| Table
Spo01801	0.66	Barchart \| Table
Spo19863	0.66	Barchart \| Table
Spo18111	0.66	Barchart \| Table
Spo17338	0.66	Barchart \| Table
Spo16587	0.66	Barchart \| Table
Spo20770	0.66	Barchart \| Table
Spo15084	0.66	Barchart \| Table
Spo13583	0.66	Barchart \| Table
Spo14938	0.66	Barchart \| Table
Spo01305	0.66	Barchart \| Table
Spo23235	0.66	Barchart \| Table
Spo14667	0.66	Barchart \| Table
Spo22054	0.66	Barchart \| Table
Spo10262	0.66	Barchart \| Table
Spo23332	0.66	Barchart \| Table
Spo22392	0.66	Barchart \| Table
Spo09387	0.66	Barchart \| Table
Spo00114	0.66	Barchart \| Table
Spo09317	0.66	Barchart \| Table
Spo21155	0.66	Barchart \| Table
Spo06953	0.66	Barchart \| Table
Spo04868	0.66	Barchart \| Table
Spo00214	0.66	Barchart \| Table
Spo04653	0.66	Barchart \| Table
Spo15461	0.65	Barchart \| Table
Spo26168	0.65	Barchart \| Table
Spo14350	0.65	Barchart \| Table
Spo11431	0.65	Barchart \| Table
Spo11196	0.65	Barchart \| Table
Spo10585	0.65	Barchart \| Table
Spo27203	0.65	Barchart \| Table
Spo09798	0.65	Barchart \| Table
Spo09008	0.65	Barchart \| Table
Spo18478	0.65	Barchart \| Table