Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAAGCCTTTGGGATCAACTGGGGAGTTCTTCAGGAGGCGCGATGAGTGGAGGAAGCACCCGACTCTCAGCAATCAGCTCCGCTTCCGCCACGCCGTTCCTGGCCTTGGGCTCGGTGTCGCCGCCTTCTGCGTTTACCTCGTCGGCGAAACCGTCTACAATCAGTTTTACTCCCCCCCTCATTCTTCCTCTTCTTCTCACCATTGA ATGGCGAAGCCTTTGGGATCAACTGGGGAGTTCTTCAGGAGGCGCGATGAGTGGAGGAAGCACCCGACTCTCAGCAATCAGCTCCGCTTCCGCCACGCCGTTCCTGGCCTTGGGCTCGGTGTCGCCGCCTTCTGCGTTTACCTCGTCGGCGAAACCGTCTACAATCAGTTTTACTCCCCCCCTCATTCTTCCTCTTCTTCTCACCATTGA ATGGCGAAGCCTTTGGGATCAACTGGGGAGTTCTTCAGGAGGCGCGATGAGTGGAGGAAGCACCCGACTCTCAGCAATCAGCTCCGCTTCCGCCACGCCGTTCCTGGCCTTGGGCTCGGTGTCGCCGCCTTCTGCGTTTACCTCGTCGGCGAAACCGTCTACAATCAGTTTTACTCCCCCCCTCATTCTTCCTCTTCTTCTCACCATTGA MAKPLGSTGEFFRRRDEWRKHPTLSNQLRFRHAVPGLGLGVAAFCVYLVGETVYNQFYSPPHSSSSSHH Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Homology
BLAST of Spo15902.1 vs. NCBI nr
Match: gi|902228204|gb|KNA21018.1| (hypothetical protein SOVF_047060 [Spinacia oleracea]) HSP 1 Score: 149.8 bits (377), Expect = 1.700e-33 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Spo15902.1 vs. NCBI nr
Match: gi|731341837|ref|XP_010682096.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 130.2 bits (326), Expect = 1.400e-27 Identity = 61/68 (89.71%), Postives = 64/68 (94.12%), Query Frame = 1
BLAST of Spo15902.1 vs. NCBI nr
Match: gi|870856290|gb|KMT07953.1| (hypothetical protein BVRB_6g144870 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 124.8 bits (312), Expect = 5.900e-26 Identity = 58/68 (85.29%), Postives = 63/68 (92.65%), Query Frame = 1
BLAST of Spo15902.1 vs. NCBI nr
Match: gi|1009179381|ref|XP_015871049.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 109.0 bits (271), Expect = 3.400e-21 Identity = 53/69 (76.81%), Postives = 58/69 (84.06%), Query Frame = 1
BLAST of Spo15902.1 vs. NCBI nr
Match: gi|18394120|ref|NP_563952.1| (NADH dehydrogenase (ubiquinone) [Arabidopsis thaliana]) HSP 1 Score: 108.6 bits (270), Expect = 4.400e-21 Identity = 52/69 (75.36%), Postives = 59/69 (85.51%), Query Frame = 1
BLAST of Spo15902.1 vs. UniProtKB/TrEMBL
Match: A0A0K9RNG7_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_047060 PE=4 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.200e-33 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Spo15902.1 vs. UniProtKB/TrEMBL
Match: A0A0J8C275_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_6g145620 PE=4 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 9.800e-28 Identity = 61/68 (89.71%), Postives = 64/68 (94.12%), Query Frame = 1
BLAST of Spo15902.1 vs. UniProtKB/TrEMBL
Match: A0A0J8C7F5_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_6g144870 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 4.100e-26 Identity = 58/68 (85.29%), Postives = 63/68 (92.65%), Query Frame = 1
BLAST of Spo15902.1 vs. UniProtKB/TrEMBL
Match: A0A078I7X8_BRANA (BnaA06g09280D protein OS=Brassica napus GN=BnaA06g09280D PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.100e-21 Identity = 52/69 (75.36%), Postives = 60/69 (86.96%), Query Frame = 1
BLAST of Spo15902.1 vs. UniProtKB/TrEMBL
Match: D7KBK4_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_471620 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.100e-21 Identity = 52/69 (75.36%), Postives = 59/69 (85.51%), Query Frame = 1
BLAST of Spo15902.1 vs. ExPASy Swiss-Prot
Match: NDB3B_ARATH (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B OS=Arabidopsis thaliana GN=At1g14450 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 2.700e-23 Identity = 52/69 (75.36%), Postives = 59/69 (85.51%), Query Frame = 1
BLAST of Spo15902.1 vs. ExPASy Swiss-Prot
Match: NDB3A_ARATH (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-A OS=Arabidopsis thaliana GN=At2g02510 PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 5.200e-22 Identity = 49/68 (72.06%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Spo15902.1 vs. TAIR (Arabidopsis)
Match: AT1G14450.1 (NADH dehydrogenase (ubiquinone)s) HSP 1 Score: 108.6 bits (270), Expect = 1.500e-24 Identity = 52/69 (75.36%), Postives = 59/69 (85.51%), Query Frame = 1
BLAST of Spo15902.1 vs. TAIR (Arabidopsis)
Match: AT2G02510.1 (NADH dehydrogenase (ubiquinone)s) HSP 1 Score: 104.4 bits (259), Expect = 2.900e-23 Identity = 49/68 (72.06%), Postives = 58/68 (85.29%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo15902.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo15902.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo15902.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 2
BLAST of Spo15902.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 2
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|